Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FGFRL1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N441
Molecular weight:
25.55 kDa

Original price was: $413.00.Current price is: $327.00.

100ug 21% OFF + 327 loyalty points
Val168–Pro378
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FGFRL1, N-His

Product name ARO-P13252-100
Uniprot ID Q8N441
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPVASSSSATSLPWP
Molecular weight 25.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val168-Pro378
Aliases /Synonyms FGF homologous factor receptor, FGFR-like protein, Fibroblast growth factor receptor 5, Fibroblast growth factor receptor-like 1, FGF receptor-like protein 1, FGFRL1, FGFR-5, FHFR, FGFR5
Reference ARO-P13252
Note For research use only.
Molecular Constructor
Val168–Pro378
Product name ARO-P13252-1MG
Uniprot ID Q8N441
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPVASSSSATSLPWP
Molecular weight 25.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val168-Pro378
Aliases /Synonyms FGF homologous factor receptor, FGFR-like protein, Fibroblast growth factor receptor 5, Fibroblast growth factor receptor-like 1, FGF receptor-like protein 1, FGFRL1, FGFR-5, FHFR, FGFR5
Reference ARO-P13252
Note For research use only.
Molecular Constructor
Val168–Pro378
Product name ARO-P13252-50
Uniprot ID Q8N441
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPVASSSSATSLPWP
Molecular weight 25.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val168-Pro378
Aliases /Synonyms FGF homologous factor receptor, FGFR-like protein, Fibroblast growth factor receptor 5, Fibroblast growth factor receptor-like 1, FGF receptor-like protein 1, FGFRL1, FGFR-5, FHFR, FGFR5
Reference ARO-P13252
Note For research use only.
Molecular Constructor
Val168–Pro378

Introduction

Recombinant Human FGFRL1 is a protein that has been artificially produced using genetic engineering techniques. It belongs to the fibroblast growth factor receptor (FGFR) family and is also known as FGFR5. This protein plays a crucial role in various biological processes, making it a valuable tool for scientific research and potential therapeutic applications.

Structure of Recombinant Human FGFRL1

The recombinant form of FGFRL1 is a 338-amino acid protein with a molecular weight of approximately 38 kDa. It consists of three domains: an extracellular ligand-binding domain, a transmembrane domain, and an intracellular tyrosine kinase domain. The extracellular domain contains three immunoglobulin-like domains, which are responsible for binding to fibroblast growth factors (FGFs). The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain is involved in signal transduction.

Activity of Recombinant Human FGFRL1

FGFRL1 is a receptor for FGFs, which are growth factors involved in cell proliferation, differentiation, and survival. Upon binding to FGFs, FGFRL1 activates downstream signaling pathways, such as the MAPK/ERK and PI3K/Akt pathways, which regulate various cellular processes. FGFRL1 has been shown to play a role in embryonic development, wound healing, and tissue repair. It is also involved in the regulation of bone metabolism and angiogenesis.

Application of Recombinant Human FGFRL1

Recombinant Human FGFRL1 has a wide range of applications in both basic research and clinical settings. Some of the key applications include:

1. Studying FGF signaling

As a receptor for FGFs, FGFRL1 is an important component of the FGF signaling pathway. Recombinant Human FGFRL1 can be used to study the binding affinity and specificity of different FGFs, as well as the downstream signaling events triggered by FGFRL1 activation. This information can help researchers better understand the role of FGF signaling in various biological processes.

2. Investigating developmental processes

FGFRL1 has been shown to play a critical role in embryonic development, particularly in the formation of the skeletal system. Recombinant Human FGFRL1 can be used to study the effects of FGFRL1 on cell proliferation, differentiation, and migration during embryonic development. This can provide valuable insights into the mechanisms underlying skeletal development and potential therapeutic targets for skeletal disorders.

3. Potential therapeutic applications

Given its involvement in various biological processes, FGFRL1 has been identified as a potential therapeutic target for several diseases. Recombinant Human FGFRL1 can be used to screen for small molecule inhibitors that can block FGFRL1 signaling and potentially treat diseases such as cancer, osteoporosis, and cardiovascular disorders.

4. Biomarker for disease diagnosis

FGFRL1 has been found to be overexpressed in certain types of cancer, making it a potential biomarker for disease diagnosis. Recombinant Human FGFRL1 can be used to develop diagnostic tests for cancer, allowing for early detection and better treatment outcomes.

5. Production of therapeutic antibodies

Recombinant Human FGFRL1 can be used as an antigen to produce specific antibodies for therapeutic purposes. These antibodies can be used to target and block FGFRL1 signaling in diseases where FGFRL1 is overexpressed, such as cancer.

Conclusion

In summary, Recombinant Human FGFRL1 is a valuable protein with diverse applications in scientific research and potential therapeutic uses. Its structure, activity, and role in various biological processes make it a promising tool for studying FGF signaling and developing treatments for diseases. With further research and development, Recombinant Human FGFRL1 has the potential to make a

Recombinant Human FGFRL1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FGFRL1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products