Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FGGY Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96C11
Molecular weight:
31.41 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Pro284–Asp551
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FGGY Protein, N-His

Product name ARO-P11523-100
Uniprot ID Q96C11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD
Molecular weight 31.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro284-Asp551
Aliases /Synonyms FGGY carbohydrate kinase domain-containing protein, FGGY
Reference ARO-P11523
Note For research use only.
Molecular Constructor
Pro284–Asp551
Product name ARO-P11523-1MG
Uniprot ID Q96C11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD
Molecular weight 31.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro284-Asp551
Aliases /Synonyms FGGY carbohydrate kinase domain-containing protein, FGGY
Reference ARO-P11523
Note For research use only.
Molecular Constructor
Pro284–Asp551
Product name ARO-P11523-50
Uniprot ID Q96C11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD
Molecular weight 31.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro284-Asp551
Aliases /Synonyms FGGY carbohydrate kinase domain-containing protein, FGGY
Reference ARO-P11523
Note For research use only.
Molecular Constructor
Pro284–Asp551

Introduction to Recombinant Human FGGY Protein

Recombinant Human FGGY Protein, also known as Fructose-1,6-bisphosphatase 1 (FBP1), is a key enzyme involved in the regulation of glucose metabolism. This protein is encoded by the FBP1 gene and is involved in the gluconeogenesis pathway, which is responsible for the production of glucose from non-carbohydrate sources in the liver and kidneys.

Structure of Recombinant Human FGGY Protein

Recombinant Human FGGY Protein is a 338 amino acid protein with a molecular weight of approximately 37 kDa. It is composed of two subunits, each containing a catalytic domain and a regulatory domain. The catalytic domain is responsible for the enzymatic activity of FBP1, while the regulatory domain helps to regulate the activity of the enzyme.

The crystal structure of Recombinant Human FGGY Protein has been determined, revealing a complex three-dimensional structure with multiple domains. The catalytic domain contains a conserved active site, which is responsible for the binding and hydrolysis of fructose-1,6-bisphosphate, the substrate of FBP1. The regulatory domain contains binding sites for allosteric regulators, such as AMP and citrate, which can modulate the activity of the enzyme.

Activity of Recombinant Human FGGY Protein

The main function of Recombinant Human FGGY Protein is to catalyze the conversion of fructose-1,6-bisphosphate to fructose-6-phosphate, an important step in the gluconeogenesis pathway. This reaction is reversible and is regulated by the levels of allosteric regulators, such as AMP and citrate, as well as by post-translational modifications, such as phosphorylation.

In addition to its role in gluconeogenesis, Recombinant Human FGGY Protein has also been found to play a role in other metabolic processes, such as lipogenesis and glycogen synthesis. This enzyme is also involved in the regulation of glucose homeostasis and insulin sensitivity.

Application of Recombinant Human FGGY Protein

Recombinant Human FGGY Protein has a wide range of applications in both research and clinical settings. One of its main uses is in the study of glucose metabolism and its dysregulation in diseases such as diabetes and metabolic syndrome. Recombinant Human FGGY Protein can be used to investigate the role of FBP1 in these conditions and to develop potential therapeutic interventions.

In addition, Recombinant Human FGGY Protein is also used in the production of diagnostic kits for the measurement of FBP1 levels in patient samples. Abnormal levels of FBP1 have been linked to various diseases, making it a potential biomarker for the early detection and monitoring of these conditions.

Furthermore, Recombinant Human FGGY Protein is also used in drug discovery and development. As FBP1 is a potential target for the treatment of metabolic disorders, inhibitors of this enzyme are being developed as potential therapeutics. Recombinant Human FGGY Protein can be used in high-throughput screening assays to identify and characterize potential inhibitors, leading to the development of new treatments for these diseases.

Conclusion

In conclusion, Recombinant Human FGGY Protein is a key enzyme involved in glucose metabolism and has a wide range of applications in research and clinical settings. Its structure and activity have been extensively studied, providing valuable insights into its role in various metabolic processes. With ongoing research and development, Recombinant Human FGGY Protein holds great potential for the diagnosis and treatment of metabolic disorders.

Recombinant Human FGGY Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FGGY Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products