Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GABRB1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P18505
Molecular weight:
23.19 kDa

Original price was: $274.00.Current price is: $230.00.

50ug 16% OFF + 230 loyalty points
Asp62–Asn242
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GABRB1 Protein, N-His

Product name ARO-P12058-100
Uniprot ID P18505
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRN
Molecular weight 23.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp62-Asn242
Aliases /Synonyms Gamma-aminobutyric acid receptor subunit beta-1, GABA(A) receptor subunit beta-1, GABRB1
Reference ARO-P12058
Note For research use only.
Molecular Constructor
Asp62–Asn242
Product name ARO-P12058-1MG
Uniprot ID P18505
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRN
Molecular weight 23.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp62-Asn242
Aliases /Synonyms Gamma-aminobutyric acid receptor subunit beta-1, GABA(A) receptor subunit beta-1, GABRB1
Reference ARO-P12058
Note For research use only.
Molecular Constructor
Asp62–Asn242
Product name ARO-P12058-50
Uniprot ID P18505
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRN
Molecular weight 23.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp62-Asn242
Aliases /Synonyms Gamma-aminobutyric acid receptor subunit beta-1, GABA(A) receptor subunit beta-1, GABRB1
Reference ARO-P12058
Note For research use only.
Molecular Constructor
Asp62–Asn242

Introduction

Recombinant Human GABRB1 Protein, also known as Gamma-Aminobutyric Acid Receptor Subunit Beta-1, is a protein that plays a crucial role in the functioning of the central nervous system. It is a key component of the GABA receptor, which is responsible for inhibitory neurotransmission in the brain. In this article, we will discuss the structure, activity, and applications of Recombinant Human GABRB1 Protein.

Structure of Recombinant Human GABRB1 Protein

The GABRB1 gene is located on chromosome 4 in humans and encodes for the GABRB1 protein. It consists of 6 exons and spans approximately 200 kilobases. The protein has a molecular weight of approximately 52 kDa and is composed of 456 amino acids. It is a member of the Cys-loop ligand-gated ion channel (LGIC) family and has a similar structure to other GABA receptor subunits.

The GABRB1 protein has a large extracellular N-terminal domain, four transmembrane domains, and a short cytoplasmic C-terminal domain. The extracellular domain contains the binding site for GABA, which is the primary inhibitory neurotransmitter in the brain. The transmembrane domains form a pore that allows the passage of chloride ions, leading to the inhibitory effect of GABA. The C-terminal domain is involved in the regulation of the receptor’s activity.

Activity of Recombinant Human GABRB1 Protein

Recombinant Human GABRB1 Protein is a critical component of the GABA receptor, which is a ligand-gated ion channel. When GABA binds to the receptor, it causes a conformational change that opens the ion channel, allowing the passage of chloride ions into the cell. This influx of chloride ions leads to an inhibitory effect on the neuron, reducing its excitability.

The activity of the GABA receptor is essential for maintaining the balance between excitation and inhibition in the brain. It plays a crucial role in various physiological processes, including motor control, cognition, and emotional regulation. Dysfunction of the GABA receptor has been linked to several neurological disorders, such as epilepsy, anxiety, and schizophrenia.

Applications of Recombinant Human GABRB1 Protein

Recombinant Human GABRB1 Protein has numerous applications in both research and therapeutic settings. Its role in the GABA receptor makes it a valuable tool for studying the mechanisms of inhibitory neurotransmission and its role in various neurological disorders.

In research, Recombinant Human GABRB1 Protein can be used to study the structure and function of the GABA receptor. It can also be used to screen for potential drugs that target the receptor and modulate its activity. Additionally, it can be used to generate antibodies for the detection and quantification of GABRB1 in various tissues and biological samples.

In therapeutic settings, Recombinant Human GABRB1 Protein can be used for the treatment of neurological disorders that involve GABA receptor dysfunction. For example, drugs that target the GABA receptor, such as benzodiazepines, are commonly used to treat anxiety and seizure disorders. Recombinant Human GABRB1 Protein can also be used in gene therapy approaches for inherited disorders that affect the GABA receptor.

Conclusion

Recombinant Human GABRB1 Protein is a crucial component of the GABA receptor, which plays a vital role in inhibitory neurotransmission in the brain. Its structure and activity are essential for maintaining the balance between excitation and inhibition in the central nervous system. In addition to its role in research, Recombinant Human GABRB1 Protein has potential therapeutic applications in the treatment of neurological disorders. Further studies on this protein and its interactions with other GABA receptor subunits could provide valuable insights into the functioning of the brain and

Recombinant Human GABRB1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GABRB1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products