Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GADD45GIP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TAE8
Molecular weight:
22.68 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Thr47–Ser222
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GADD45GIP1 Protein, N-His

Product name ARO-P11669-100
Uniprot ID Q8TAE8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Molecular weight 22.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr47-Ser222
Aliases /Synonyms CRIF1, GADD45GIP1, 39S ribosomal protein L59, mitochondrial, PLINP1, PLINP, MRP-L59, CKII beta-associating protein, Papillomavirus L2-interacting nuclear protein 1, PLINP-1, PRG6, CR6-interacting factor 1, MRPL59, p53-responsive gene 6 protein, Growth arrest and DNA damage-inducible proteins-interacting protein 1, Mitochondrial large ribosomal subunit protein mL64
Reference ARO-P11669
Note For research use only.
Molecular Constructor
Thr47–Ser222
Product name ARO-P11669-1MG
Uniprot ID Q8TAE8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Molecular weight 22.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr47-Ser222
Aliases /Synonyms CRIF1, GADD45GIP1, 39S ribosomal protein L59, mitochondrial, PLINP1, PLINP, MRP-L59, CKII beta-associating protein, Papillomavirus L2-interacting nuclear protein 1, PLINP-1, PRG6, CR6-interacting factor 1, MRPL59, p53-responsive gene 6 protein, Growth arrest and DNA damage-inducible proteins-interacting protein 1, Mitochondrial large ribosomal subunit protein mL64
Reference ARO-P11669
Note For research use only.
Molecular Constructor
Thr47–Ser222
Product name ARO-P11669-50
Uniprot ID Q8TAE8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Molecular weight 22.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr47-Ser222
Aliases /Synonyms CRIF1, GADD45GIP1, 39S ribosomal protein L59, mitochondrial, PLINP1, PLINP, MRP-L59, CKII beta-associating protein, Papillomavirus L2-interacting nuclear protein 1, PLINP-1, PRG6, CR6-interacting factor 1, MRPL59, p53-responsive gene 6 protein, Growth arrest and DNA damage-inducible proteins-interacting protein 1, Mitochondrial large ribosomal subunit protein mL64
Reference ARO-P11669
Note For research use only.
Molecular Constructor
Thr47–Ser222

Introduction

Recombinant Human GADD45GIP1 Protein, also known as Growth Arrest and DNA Damage-Inducible Protein 45 Gamma-Interacting Protein 1, is a protein that plays a crucial role in cell cycle regulation and DNA damage response. This protein is produced through recombinant DNA technology, which involves inserting the gene for GADD45GIP1 into a host organism, such as bacteria, to produce large quantities of the protein for research and therapeutic purposes.

Structure of Recombinant Human GADD45GIP1 Protein

The Recombinant Human GADD45GIP1 Protein is a 17 kDa protein that consists of 151 amino acids. It contains a conserved N-terminal domain that is responsible for binding to the GADD45 family of proteins, as well as a C-terminal domain that is involved in protein-protein interactions. The protein also contains a nuclear localization signal, which allows it to be transported into the nucleus where it carries out its functions.

Activity of Recombinant Human GADD45GIP1 Protein

Recombinant Human GADD45GIP1 Protein is a multifunctional protein that plays a role in various cellular processes. It is primarily known for its involvement in the cell cycle, where it acts as a negative regulator of cell proliferation. It does this by binding to and inhibiting the activity of cyclin-dependent kinases, which are enzymes that promote cell division.

In addition to its role in the cell cycle, Recombinant Human GADD45GIP1 Protein is also involved in the DNA damage response. It is upregulated in response to DNA damage and helps to repair damaged DNA by activating the checkpoint kinase 1 (Chk1) pathway. This pathway is responsible for halting the cell cycle and allowing time for DNA repair to occur.

Furthermore, Recombinant Human GADD45GIP1 Protein has been shown to play a role in apoptosis, or programmed cell death. It promotes apoptosis by interacting with and activating the tumor suppressor protein p53, which is known to induce cell death in response to DNA damage.

Applications of Recombinant Human GADD45GIP1 Protein

Recombinant Human GADD45GIP1 Protein has a wide range of applications in both research and therapeutic settings. In research, it is commonly used as a tool to study cell cycle regulation and DNA damage response. Its ability to inhibit cell proliferation and promote apoptosis makes it a valuable tool for studying cancer and other diseases that involve abnormal cell growth.

In a therapeutic context, Recombinant Human GADD45GIP1 Protein has potential applications in cancer treatment. Its role in inhibiting cell proliferation and promoting apoptosis makes it a promising target for developing anti-cancer drugs. Additionally, its involvement in the DNA damage response makes it a potential candidate for enhancing the effectiveness of chemotherapy and radiation therapy.

Conclusion

In summary, Recombinant Human GADD45GIP1 Protein is a 17 kDa protein that plays a crucial role in cell cycle regulation and DNA damage response. Its structure consists of a conserved N-terminal domain, a C-terminal domain, and a nuclear localization signal. The protein is involved in various cellular processes, including cell cycle regulation, DNA repair, and apoptosis. Its multifunctional nature makes it a valuable tool for research and a potential candidate for cancer treatment.

Recombinant Human GADD45GIP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GADD45GIP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products