Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GORAB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5T7V8
Molecular weight:
16.30 kDa

Original price was: $367.00.Current price is: $327.00.

100ug 11% OFF + 327 loyalty points
Met156–Asp275
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GORAB Protein, N-His

Product name ARO-P11290-100
Uniprot ID Q5T7V8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMQQLD
Molecular weight 16.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met156-Asp275
Aliases /Synonyms NTKLBP1, NTKL-BP1, SCYL1-binding protein 1, SCYL1BP1, SCY1-like 1-binding protein 1, GORAB, NTKL-binding protein 1, SCYL1-BP1, hNTKL-BP1, RAB6-interacting golgin, N-terminal kinase-like-binding protein 1
Reference ARO-P11290
Note For research use only.
Molecular Constructor
Met156–Asp275
Product name ARO-P11290-1MG
Uniprot ID Q5T7V8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMQQLD
Molecular weight 16.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met156-Asp275
Aliases /Synonyms NTKLBP1, NTKL-BP1, SCYL1-binding protein 1, SCYL1BP1, SCY1-like 1-binding protein 1, GORAB, NTKL-binding protein 1, SCYL1-BP1, hNTKL-BP1, RAB6-interacting golgin, N-terminal kinase-like-binding protein 1
Reference ARO-P11290
Note For research use only.
Molecular Constructor
Met156–Asp275
Product name ARO-P11290-50
Uniprot ID Q5T7V8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMQQLD
Molecular weight 16.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met156-Asp275
Aliases /Synonyms NTKLBP1, NTKL-BP1, SCYL1-binding protein 1, SCYL1BP1, SCY1-like 1-binding protein 1, GORAB, NTKL-binding protein 1, SCYL1-BP1, hNTKL-BP1, RAB6-interacting golgin, N-terminal kinase-like-binding protein 1
Reference ARO-P11290
Note For research use only.
Molecular Constructor
Met156–Asp275

Introduction

Recombinant Human GORAB Protein, also known as Golgin-245-Related Protein, is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein plays a crucial role in regulating the structure and function of the Golgi apparatus, a cellular organelle involved in protein processing and trafficking.

Structure of Recombinant Human GORAB Protein

Recombinant Human GORAB Protein is a 21 kDa protein consisting of 189 amino acids. It contains a single N-terminal transmembrane domain and a C-terminal coiled-coil domain, which is essential for its function in maintaining the structure of the Golgi apparatus.

Activity of Recombinant Human GORAB Protein

The main function of Recombinant Human GORAB Protein is to regulate the structure and dynamics of the Golgi apparatus. It does so by interacting with other Golgi-associated proteins, such as GM130 and GRASP65, to form a protein complex that is essential for maintaining the structural integrity of the Golgi apparatus. This protein complex also plays a role in the organization and positioning of the Golgi within the cell.

Furthermore, Recombinant Human GORAB Protein has been shown to be involved in the transport of proteins and lipids within the Golgi apparatus, as well as in the formation of transport vesicles that are responsible for delivering cargo to their final destinations within the cell.

Application of Recombinant Human GORAB Protein

The unique structure and activity of Recombinant Human GORAB Protein make it a valuable tool for various research purposes. Some of its applications include:

  • Study of Golgi apparatus structure and function: Recombinant Human GORAB Protein can be used to study the role of the Golgi apparatus in protein processing and trafficking, as well as its involvement in various cellular processes.
  • Drug discovery and development: As the Golgi apparatus is a target for many diseases, Recombinant Human GORAB Protein can be used to screen potential drugs that can modulate its activity and potentially treat diseases associated with Golgi dysfunction.
  • Biotechnology and protein engineering: Recombinant Human GORAB Protein can be used to engineer and modify the structure and function of the Golgi apparatus, which can have implications in the production of recombinant proteins and other biotechnological processes.

Conclusion

In summary, Recombinant Human GORAB Protein is a vital component in regulating the structure and function of the Golgi apparatus. Its unique structure and activity make it an important tool for research, drug discovery, and biotechnology. With its multiple applications, this protein continues to contribute to our understanding of cellular processes and has the potential to impact various fields of science and medicine.

Recombinant Human GORAB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GORAB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products