Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPA33, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99795
Molecular weight:
25.92 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Ile22–Val235
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPA33, N-His

Product name ARO-P13145-100
Uniprot ID Q99795
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
Molecular weight 25.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile22-Val235
Aliases /Synonyms Cell surface A33 antigen, GPA33, Glycoprotein A33
Reference ARO-P13145
Note For research use only.
Molecular Constructor
Ile22–Val235
Product name ARO-P13145-1MG
Uniprot ID Q99795
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
Molecular weight 25.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile22-Val235
Aliases /Synonyms Cell surface A33 antigen, GPA33, Glycoprotein A33
Reference ARO-P13145
Note For research use only.
Molecular Constructor
Ile22–Val235
Product name ARO-P13145-50
Uniprot ID Q99795
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
Molecular weight 25.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile22-Val235
Aliases /Synonyms Cell surface A33 antigen, GPA33, Glycoprotein A33
Reference ARO-P13145
Note For research use only.
Molecular Constructor
Ile22–Val235

Introduction

Recombinant Human GPA33, also known as Glycoprotein A33, is a protein that is encoded by the GPA33 gene. It is a transmembrane glycoprotein that is predominantly expressed in the epithelial cells of the gastrointestinal tract. This protein has been extensively studied for its structure, activity, and potential applications in various fields.

Structure of Recombinant Human GPA33

Recombinant Human GPA33 is a type I transmembrane protein with a molecular weight of approximately 40 kDa. It is composed of 367 amino acids and has a predicted N-terminal signal peptide, an extracellular domain, a transmembrane domain, and a cytoplasmic tail. The extracellular domain of GPA33 contains several conserved domains, including an immunoglobulin-like domain, a mucin-like domain, and a C-type lectin domain. These domains play important roles in the protein’s function and interactions with other molecules.

Activity of Recombinant Human GPA33

The exact function of Recombinant Human GPA33 is still not fully understood, but it has been shown to play a role in cell adhesion and cell signaling. Studies have also suggested that GPA33 may be involved in the regulation of cell proliferation and differentiation. Additionally, it has been found to be highly expressed in colorectal cancer cells, suggesting a potential role in cancer development and progression.

One of the most interesting activities of Recombinant Human GPA33 is its ability to interact with specific antibodies, making it an attractive target for antibody-based therapies. This interaction has been studied in various cancer types, including colorectal, pancreatic, and ovarian cancers. In fact, GPA33 has been identified as a potential biomarker for early detection and targeted therapy of colorectal cancer.

Application of Recombinant Human GPA33

Recombinant Human GPA33 has a wide range of potential applications in the fields of medicine, biotechnology, and research. One of the most promising applications is in cancer diagnosis and treatment. As mentioned earlier, GPA33 is highly expressed in colorectal cancer cells, making it a potential biomarker for early detection and targeted therapy. Its interaction with specific antibodies also makes it a potential target for antibody-based therapies.

In addition to cancer, Recombinant Human GPA33 has also been studied for its potential role in inflammatory bowel disease (IBD). Studies have shown that GPA33 is upregulated in patients with IBD, suggesting a potential role in the pathogenesis of this disease. This protein could potentially be used as a therapeutic target or diagnostic marker for IBD.

Moreover, Recombinant Human GPA33 has been used in various research studies to understand its structure, function, and potential interactions with other molecules. Its ability to interact with specific antibodies has also made it a valuable tool in antibody engineering and drug discovery.

Conclusion

In conclusion, Recombinant Human GPA33 is a transmembrane glycoprotein with a molecular weight of 40 kDa. It has a complex structure with several conserved domains that play important roles in its function. Although its exact function is still not fully understood, it has been shown to be involved in cell adhesion, signaling, and potentially cancer development and progression. Recombinant Human GPA33 has a wide range of potential applications in cancer diagnosis and treatment, IBD, and research. Further studies on this protein are needed to fully understand its role and potential in different fields.

Recombinant Human GPA33, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GPA33, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products