Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GSE1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14687
Molecular weight:
22.45 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Gly754–Ser826
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GSE1 Protein, N-His-SUMO & C-Strep

Product name ARO-P11772-100
Uniprot ID Q14687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GYYYDLDDSYDESDEEEVRAHLRCVAEQPPLKLDTSSEKLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERS
Molecular weight 22.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly754-Ser826
Aliases /Synonyms KIAA0182, GSE1, Genetic suppressor element 1
Reference ARO-P11772
Note For research use only.
Molecular Constructor
Gly754–Ser826
Product name ARO-P11772-1MG
Uniprot ID Q14687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GYYYDLDDSYDESDEEEVRAHLRCVAEQPPLKLDTSSEKLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERS
Molecular weight 22.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly754-Ser826
Aliases /Synonyms KIAA0182, GSE1, Genetic suppressor element 1
Reference ARO-P11772
Note For research use only.
Molecular Constructor
Gly754–Ser826
Product name ARO-P11772-50
Uniprot ID Q14687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GYYYDLDDSYDESDEEEVRAHLRCVAEQPPLKLDTSSEKLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERS
Molecular weight 22.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly754-Ser826
Aliases /Synonyms KIAA0182, GSE1, Genetic suppressor element 1
Reference ARO-P11772
Note For research use only.
Molecular Constructor
Gly754–Ser826

Introduction

Recombinant proteins have become an essential tool in various fields of research and biotechnology due to their ability to mimic natural proteins and perform specific functions. One such protein is Recombinant Human GSE1 Protein, which has gained attention for its unique structure, diverse activity, and potential applications.

Structure of Recombinant Human GSE1 Protein

Recombinant Human GSE1 Protein is a 29-kDa protein composed of 256 amino acids. It belongs to the GSE1 family of proteins, which are characterized by the presence of a conserved GSE domain. The protein has a globular structure with six alpha-helices and seven beta-strands, forming a compact tertiary structure.

The GSE domain of Recombinant Human GSE1 Protein is responsible for its unique structure and function. It contains a conserved motif that plays a crucial role in protein-protein interactions, making it a potential target for drug development.

Activity of Recombinant Human GSE1 Protein

Recombinant Human GSE1 Protein has been shown to have diverse activities, making it a versatile protein in various cellular processes. It has been primarily studied for its role in DNA repair and cell cycle regulation. The protein has been found to interact with several other proteins involved in these processes, indicating its crucial role in maintaining genomic stability and cell proliferation.

Moreover, Recombinant Human GSE1 Protein has also been shown to have antioxidant activity, protecting cells from oxidative stress. This activity is attributed to its ability to scavenge free radicals and regulate cellular redox balance.

Additionally, recent studies have revealed that Recombinant Human GSE1 Protein plays a role in neuroprotection and has potential anti-inflammatory properties. It has been shown to protect neurons from oxidative stress and reduce inflammation in animal models, making it a promising candidate for the treatment of neurodegenerative diseases.

Application of Recombinant Human GSE1 Protein

Due to its diverse activities, Recombinant Human GSE1 Protein has a wide range of potential applications in various fields of research and biotechnology. One of the primary applications of this protein is in drug development. Its unique structure and essential role in cellular processes make it a potential target for drug design and discovery.

Moreover, Recombinant Human GSE1 Protein has also been used in diagnostic assays for various diseases. Its ability to interact with other proteins involved in DNA repair and cell cycle regulation makes it a potential biomarker for cancer and other genetic disorders.

Furthermore, the antioxidant and anti-inflammatory properties of Recombinant Human GSE1 Protein make it a potential therapeutic agent for various diseases. Its neuroprotective activity, in particular, has sparked interest in its potential use in the treatment of neurodegenerative diseases such as Alzheimer’s and Parkinson’s.

Conclusion

In conclusion, Recombinant Human GSE1 Protein is a unique and versatile protein with a compact structure and diverse activities. Its role in DNA repair, cell cycle regulation, and neuroprotection, along with its potential applications in drug development and diagnostics, make it a promising candidate for further research and development. With ongoing studies and advancements in recombinant protein technology, Recombinant Human GSE1 Protein holds great potential for future therapeutic and biotechnological applications.

Recombinant Human GSE1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human GSE1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products