Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GYG1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P46976
Molecular weight:
36.05 kDa

Original price was: $370.00.Current price is: $327.00.

100ug 12% OFF + 327 loyalty points
Thr2–Gly215
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GYG1 Protein, N-His-SUMO

Product name ARO-P11320-100
Uniprot ID P46976
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLG
Molecular weight 36.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly215
Aliases /Synonyms GN-1, GN1, GYG, Glycogenin-1, GYG1
Reference ARO-P11320
Note For research use only.
Molecular Constructor
Thr2–Gly215
Product name ARO-P11320-1MG
Uniprot ID P46976
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLG
Molecular weight 36.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly215
Aliases /Synonyms GN-1, GN1, GYG, Glycogenin-1, GYG1
Reference ARO-P11320
Note For research use only.
Molecular Constructor
Thr2–Gly215
Product name ARO-P11320-50
Uniprot ID P46976
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLG
Molecular weight 36.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly215
Aliases /Synonyms GN-1, GN1, GYG, Glycogenin-1, GYG1
Reference ARO-P11320
Note For research use only.
Molecular Constructor
Thr2–Gly215

Introduction

Recombinant Human GYG1 Protein, also known as Glycogenin-1, is a key enzyme involved in the synthesis of glycogen, which is the main storage form of glucose in the body. This protein is encoded by the GYG1 gene and is highly conserved across species. Recombinant Human GYG1 Protein is produced through genetic engineering techniques, making it a valuable tool in various research and industrial applications.

Structure of Recombinant Human GYG1 Protein

Recombinant Human GYG1 Protein is a single polypeptide chain consisting of 361 amino acids with a molecular weight of approximately 40 kDa. It contains a glycogenin-1 domain, a glycogenin-2 domain, and a C-terminal domain. The protein also has a conserved glycogenin signature motif and a putative glycogenin active site, which are essential for its enzymatic activity.

Activity of Recombinant Human GYG1 Protein

Recombinant Human GYG1 Protein plays a crucial role in the initiation of glycogen synthesis. It acts as a self-glucosylating enzyme, catalyzing the transfer of glucose from UDP-glucose to a specific tyrosine residue on its own polypeptide chain. This results in the formation of a short glucose polymer, which serves as a primer for the addition of more glucose molecules to form glycogen. This process is known as glycogenin-mediated glycogen synthesis and is essential for the regulation of glucose metabolism in the body.

In addition to its role in glycogen synthesis, Recombinant Human GYG1 Protein has been shown to have other important functions. It has been reported to interact with various proteins involved in glycogen metabolism, such as glycogen synthase, glycogen phosphorylase, and glycogenin-2. These interactions are crucial for the proper functioning of the glycogen synthesis pathway.

Application of Recombinant Human GYG1 Protein

The production of Recombinant Human GYG1 Protein has revolutionized the study of glycogen metabolism and its associated disorders. This protein is widely used as an antigen in various immunoassays, including ELISA and Western blot, for the detection and quantification of glycogenin levels in biological samples. It has also been used in structural studies to elucidate the mechanism of glycogenin-mediated glycogen synthesis.

Moreover, Recombinant Human GYG1 Protein has potential therapeutic applications in the treatment of glycogen storage diseases (GSDs). GSDs are a group of inherited metabolic disorders characterized by abnormal glycogen deposition in various tissues, resulting in severe health complications. Recombinant Human GYG1 Protein can be used as a therapeutic agent to restore glycogen synthesis in GSD patients, thereby improving their overall health and quality of life.

Furthermore, Recombinant Human GYG1 Protein has been utilized in the development of novel drugs targeting glycogen metabolism. It has been shown to interact with small molecules and natural compounds, which can modulate its activity and potentially serve as lead compounds for drug development. This highlights the potential of Recombinant Human GYG1 Protein in the pharmaceutical industry.

Conclusion

In summary, Recombinant Human GYG1 Protein is a crucial enzyme involved in glycogen synthesis, with a well-defined structure and activity. Its production through genetic engineering has enabled its widespread use in various research and industrial applications. With its potential therapeutic and pharmaceutical applications, Recombinant Human GYG1 Protein continues to be a valuable tool in the study of glycogen metabolism and its associated disorders.

Recombinant Human GYG1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human GYG1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products