Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HEPC/Hepcidin Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P81172
Molecular weight:
35.12 kDa

+ 387 loyalty points
GST Ser25–Thr84 His

This product is currently out of stock and unavailable.

  • Out of Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HEPC/Hepcidin Protein, N-GST & C-His

Product name Recombinant Human HEPC/Hepcidin Protein, N-GST & C-His
Uniprot ID P81172
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Molecular weight 35.12 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser25-Thr84
Aliases /Synonyms Putative liver tumor regressor, HEPC, LEAP-1, Liver-expressed antimicrobial peptide 1, PLTR, Hepcidin, LEAP1, Hepc25, Hepc20, HAMP
Reference ARO-P16715
Note For research use only.
Molecular Constructor
GST Ser25–Thr84 His

SDS-PAGE for Recombinant Human HEPC/Hepcidin Protein, N-GST & C-His

SDS-PAGE for Recombinant Human HEPC/Hepcidin Protein, N-GST & C-His

Recombinant Human HEPC/Hepcidin Protein, N-GST & C-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Human HEPC/Hepcidin Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products