Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HES5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5TA89
Molecular weight:
16.10 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Met1–Arg121
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HES5 Protein, N-His

Product name ARO-P11660-100
Uniprot ID Q5TA89
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
Molecular weight 16.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg121
Aliases /Synonyms BHLHB38, Transcription factor HES-5, Class B basic helix-loop-helix protein 38, bHLHb38, Hairy and enhancer of split 5, HES5
Reference ARO-P11660
Note For research use only.
Molecular Constructor
Met1–Arg121
Product name ARO-P11660-1MG
Uniprot ID Q5TA89
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
Molecular weight 16.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg121
Aliases /Synonyms BHLHB38, Transcription factor HES-5, Class B basic helix-loop-helix protein 38, bHLHb38, Hairy and enhancer of split 5, HES5
Reference ARO-P11660
Note For research use only.
Molecular Constructor
Met1–Arg121
Product name ARO-P11660-50
Uniprot ID Q5TA89
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
Molecular weight 16.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg121
Aliases /Synonyms BHLHB38, Transcription factor HES-5, Class B basic helix-loop-helix protein 38, bHLHb38, Hairy and enhancer of split 5, HES5
Reference ARO-P11660
Note For research use only.
Molecular Constructor
Met1–Arg121

Introduction to Recombinant Human HES5 Protein

Recombinant Human HES5 Protein, also known as Human Hairy and Enhancer of Split 5, is a protein that plays a crucial role in the development and maintenance of various tissues in the human body. It belongs to the HES family of transcription factors and is encoded by the HES5 gene located on chromosome 1. Recombinant Human HES5 Protein is produced through recombinant DNA technology and has a wide range of applications in the field of biotechnology and medicine.

Structure of Recombinant Human HES5 Protein

Recombinant Human HES5 Protein is a 33 kDa protein consisting of 262 amino acids. It contains a basic helix-loop-helix (bHLH) domain, which is responsible for its DNA-binding and transcriptional regulatory functions. This domain is highly conserved among all members of the HES family and is essential for their function. Recombinant Human HES5 Protein also has a C-terminal WRPW motif, which is involved in protein-protein interactions and plays a crucial role in its transcriptional repression activity.

Activity of Recombinant Human HES5 Protein

Recombinant Human HES5 Protein is a transcription factor that regulates gene expression by binding to specific DNA sequences. It acts as a transcriptional repressor, inhibiting the expression of target genes by recruiting co-repressors and chromatin-modifying enzymes. This activity is crucial for the development and maintenance of various tissues, including the nervous system, skeletal muscle, and pancreas.

In the nervous system, Recombinant Human HES5 Protein is involved in the regulation of neural stem cell proliferation and differentiation. It maintains the balance between self-renewal and differentiation of neural stem cells, thereby ensuring proper brain development. In skeletal muscle, Recombinant Human HES5 Protein plays a role in the regulation of myogenesis, the process of muscle cell formation. It inhibits the expression of myogenic regulatory factors, which are essential for muscle cell differentiation, thus maintaining the pool of undifferentiated muscle stem cells.

In the pancreas, Recombinant Human HES5 Protein is involved in the regulation of pancreatic cell fate determination. It promotes the formation of endocrine cells, which are responsible for the production of hormones such as insulin and glucagon. Recombinant Human HES5 Protein also plays a role in the maintenance of pancreatic beta cells, which are responsible for the production of insulin. Dysfunction of Recombinant Human HES5 Protein has been linked to various diseases, including neurodegenerative disorders, muscular dystrophies, and diabetes.

Application of Recombinant Human HES5 Protein

Recombinant Human HES5 Protein has a wide range of applications in the field of biotechnology and medicine. It is commonly used as a research tool to study the role of HES family proteins in various cellular processes. Recombinant Human HES5 Protein is also used in the production of therapeutic proteins, such as insulin, through genetic engineering. Its ability to regulate gene expression makes it a promising candidate for the treatment of diseases caused by gene dysregulation.

In addition, Recombinant Human HES5 Protein has potential applications in regenerative medicine. Its role in the regulation of stem cell proliferation and differentiation makes it a valuable tool for the development of stem cell-based therapies. It can be used to control the differentiation of stem cells into specific cell types, which can then be used for tissue repair and regeneration.

In conclusion, Recombinant Human HES5 Protein is a crucial protein with diverse functions in the human body. Its structure, activity, and applications make it an important protein for research and potential therapeutic use. Further studies on Recombinant Human HES5 Protein are needed to fully understand its role in various cellular processes and to harness its potential for the treatment of diseases.

Recombinant Human HES5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human HES5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products