Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HK3, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52790
Molecular weight:
27.52 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
His Tyr673–Ser903
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HK3, N-His

Product name ARO-P13648-100
Uniprot ID P52790
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGDDGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLCGAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGS
Molecular weight 27.52 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr673-Ser903
Aliases /Synonyms Hexokinase-C, Hexokinase type III, HK3, Hexokinase-3, HK III
Reference ARO-P13648
Note For research use only.
Molecular Constructor
His Tyr673–Ser903
Product name ARO-P13648-1MG
Uniprot ID P52790
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGDDGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLCGAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGS
Molecular weight 27.52 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr673-Ser903
Aliases /Synonyms Hexokinase-C, Hexokinase type III, HK3, Hexokinase-3, HK III
Reference ARO-P13648
Note For research use only.
Molecular Constructor
His Tyr673–Ser903
Product name ARO-P13648-50
Uniprot ID P52790
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGDDGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLCGAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGS
Molecular weight 27.52 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr673-Ser903
Aliases /Synonyms Hexokinase-C, Hexokinase type III, HK3, Hexokinase-3, HK III
Reference ARO-P13648
Note For research use only.
Molecular Constructor
His Tyr673–Ser903

Title: Introduction to Recombinant Human HK3
Recombinant Human HK3: A Versatile Protein for Research and Therapeutic Applications

Recombinant Human HK3, also known as Hexokinase 3, is a key enzyme involved in glucose metabolism. This protein is encoded by the HK3 gene and is expressed in various tissues, including the liver, brain, and muscle. Recombinant Human HK3 is produced through genetic engineering techniques, making it a valuable tool for scientific research and potential therapeutic applications.

Structure of Recombinant Human HK3
Recombinant Human HK3 is a 100 kDa protein consisting of 917 amino acids. It belongs to the hexokinase family, which also includes HK1, HK2, and HK4. The crystal structure of Recombinant Human HK3 has been determined, revealing a similar structure to other hexokinases, with a large catalytic domain and a smaller regulatory domain.

Activity of Recombinant Human HK3
Recombinant Human HK3 catalyzes the first step of glucose metabolism, converting glucose to glucose-6-phosphate. This reaction is essential for the cell’s energy production and is tightly regulated. Recombinant Human HK3 has a high affinity for glucose, allowing it to efficiently convert glucose to glucose-6-phosphate even at low concentrations.

In addition to its role in glucose metabolism, Recombinant Human HK3 has been shown to have other activities. It has been reported to interact with other proteins, such as the tumor suppressor p53, and to have anti-apoptotic effects. These additional functions of Recombinant Human HK3 are still being studied and may have implications in various diseases.

Applications of Recombinant Human HK3
Recombinant Human HK3 has a wide range of applications in scientific research and potential therapeutic uses. Its role in glucose metabolism makes it a valuable tool for studying metabolic disorders, such as diabetes and cancer. Recombinant Human HK3 has also been used in drug discovery, as it is a potential target for developing novel therapies for metabolic diseases.

Moreover, Recombinant Human HK3 has been investigated for its potential as a biomarker for various diseases. Studies have shown that HK3 expression is altered in certain cancers, making it a potential diagnostic and prognostic marker. Recombinant Human HK3 has also been studied in neurological disorders, as it is highly expressed in the brain and may play a role in neurodegenerative diseases.

Recombinant Human HK3 has also shown promise in therapeutic applications. It has been explored as a potential treatment for metabolic disorders, such as diabetes and obesity. Recombinant Human HK3 has also been studied in cancer therapy, as it may have anti-tumor effects and could be used in combination with other treatments.

Conclusion
In summary, Recombinant Human HK3 is a crucial enzyme involved in glucose metabolism, with potential additional functions and applications. Its structure has been well-characterized, and its activity has been extensively studied. Recombinant Human HK3 has a wide range of applications in scientific research and potential therapeutic uses, making it a valuable protein for various fields of study. With ongoing research and advancements in genetic engineering techniques, Recombinant Human HK3 holds great potential for future discoveries and developments in the fields of medicine and biotechnology.

Recombinant Human HK3, N-His

There are no reviews yet.

Be the first to review “Recombinant Human HK3, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products