Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HSD3B2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P26439
Molecular weight:
34.05 kDa

Original price was: $505.00.Current price is: $392.00.

100ug 22% OFF + 392 loyalty points
Met1–Pro286
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HSD3B2 Protein, N-His

Product name ARO-P12095-100
Uniprot ID P26439
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP
Molecular weight 34.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro286
Aliases /Synonyms 3-beta-hydroxy-5-ene steroid dehydrogenase, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, Progesterone reductase, 3-beta-HSD adrenal and gonadal type, HSDB3B, 3-beta-HSD II, HSD3B2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, Delta-5-3-ketosteroid isomerase
Reference ARO-P12095
Note For research use only.
Molecular Constructor
Met1–Pro286
Product name ARO-P12095-1MG
Uniprot ID P26439
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP
Molecular weight 34.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro286
Aliases /Synonyms 3-beta-hydroxy-5-ene steroid dehydrogenase, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, Progesterone reductase, 3-beta-HSD adrenal and gonadal type, HSDB3B, 3-beta-HSD II, HSD3B2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, Delta-5-3-ketosteroid isomerase
Reference ARO-P12095
Note For research use only.
Molecular Constructor
Met1–Pro286
Product name ARO-P12095-50
Uniprot ID P26439
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP
Molecular weight 34.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro286
Aliases /Synonyms 3-beta-hydroxy-5-ene steroid dehydrogenase, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, Progesterone reductase, 3-beta-HSD adrenal and gonadal type, HSDB3B, 3-beta-HSD II, HSD3B2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, Delta-5-3-ketosteroid isomerase
Reference ARO-P12095
Note For research use only.
Molecular Constructor
Met1–Pro286

Recombinant Human HSD3B2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human HSD3B2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products