Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL17B, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UHF5
Molecular weight:
20.45 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Gln21–Phe180
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL17B, N-His

Product name ARO-P13027-100
Uniprot ID Q9UHF5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCI
Molecular weight 20.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln21-Phe180
Aliases /Synonyms Interleukin-17B, IL20, Cytokine Zcyto7, IL17B, IL-20, Interleukin-20, NIRF, Neuronal interleukin-17-related factor, ZCYTO7, IL-17B
Reference ARO-P13027
Note For research use only.
Molecular Constructor
Gln21–Phe180
Product name ARO-P13027-1MG
Uniprot ID Q9UHF5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCI
Molecular weight 20.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln21-Phe180
Aliases /Synonyms Interleukin-17B, IL20, Cytokine Zcyto7, IL17B, IL-20, Interleukin-20, NIRF, Neuronal interleukin-17-related factor, ZCYTO7, IL-17B
Reference ARO-P13027
Note For research use only.
Molecular Constructor
Gln21–Phe180
Product name ARO-P13027-50
Uniprot ID Q9UHF5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCI
Molecular weight 20.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln21-Phe180
Aliases /Synonyms Interleukin-17B, IL20, Cytokine Zcyto7, IL17B, IL-20, Interleukin-20, NIRF, Neuronal interleukin-17-related factor, ZCYTO7, IL-17B
Reference ARO-P13027
Note For research use only.
Molecular Constructor
Gln21–Phe180

Introduction to Recombinant Human IL17B

Recombinant Human IL17B is a protein that is produced using recombinant DNA technology, making it identical to the naturally occurring human IL17B protein. This protein is a member of the interleukin-17 (IL-17) family, which plays a crucial role in the immune response and inflammation. In this article, we will explore the structure, activity, and applications of Recombinant Human IL17B.

Structure of Recombinant Human IL17B

Recombinant Human IL17B is a small protein consisting of 136 amino acids with a molecular weight of approximately 15 kDa. It is composed of four alpha-helices and forms a homodimer, meaning it consists of two identical subunits. Each subunit has a characteristic cysteine-knot structure, which is a common feature of all IL-17 family members.

The crystal structure of Recombinant Human IL17B has been determined, revealing the specific interactions between the two subunits. The homodimeric structure of this protein is essential for its biological activity, as it allows for the binding of IL17B to its receptor.

Activity of Recombinant Human IL17B

Recombinant Human IL17B is a pro-inflammatory cytokine, meaning it promotes inflammation in the body. It exerts its activity by binding to its receptor, IL-17RB, which is expressed on various immune cells, including T cells, B cells, and macrophages.

Upon binding to its receptor, Recombinant Human IL17B activates a signaling pathway that leads to the production of other pro-inflammatory cytokines, such as IL-6 and TNF-alpha. These cytokines play a crucial role in the immune response and are involved in the recruitment and activation of immune cells to the site of inflammation.

In addition to its pro-inflammatory activity, Recombinant Human IL17B has also been shown to promote the growth and survival of certain cancer cells. This suggests that it may play a role in tumorigenesis and cancer progression.

Applications of Recombinant Human IL17B

Recombinant Human IL17B has a wide range of applications in both research and clinical settings. Its pro-inflammatory activity makes it a valuable tool for studying the immune response and inflammation in various diseases.

In research, Recombinant Human IL17B is commonly used to stimulate immune cells in vitro to study their response and production of pro-inflammatory cytokines. It can also be used to induce inflammation in animal models to study the underlying mechanisms and potential therapeutic interventions.

In the clinic, Recombinant Human IL17B has potential applications in the treatment of inflammatory diseases, such as rheumatoid arthritis and psoriasis. It may also have a role in cancer therapy, as targeting the IL-17 signaling pathway has been shown to inhibit tumor growth and metastasis.

Conclusion

Recombinant Human IL17B is a pro-inflammatory cytokine that plays a crucial role in the immune response and inflammation. Its homodimeric structure and ability to bind to its receptor make it a potent activator of pro-inflammatory signaling pathways. This protein has various applications in research and potential therapeutic uses in the treatment of inflammatory diseases and cancer. Further studies on Recombinant Human IL17B may provide valuable insights into the mechanisms of inflammation and potential treatments for related diseases.

Recombinant Human IL17B, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL17B, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products