Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL1RAP, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NPH3
Molecular weight:
23.63 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Gly65–Asn249
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL1RAP, N-His

Product name ARO-P13075-100
Uniprot ID Q9NPH3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPN
Molecular weight 23.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly65-Asn249
Aliases /Synonyms IL-1R3, C3orf13, Interleukin-1 receptor 3, Interleukin-1 receptor accessory protein, IL1RAP, IL-1R-3, IL-1 receptor accessory protein, IL1R3, IL-1RAcP
Reference ARO-P13075
Note For research use only.
Molecular Constructor
Gly65–Asn249
Product name ARO-P13075-1MG
Uniprot ID Q9NPH3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPN
Molecular weight 23.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly65-Asn249
Aliases /Synonyms IL-1R3, C3orf13, Interleukin-1 receptor 3, Interleukin-1 receptor accessory protein, IL1RAP, IL-1R-3, IL-1 receptor accessory protein, IL1R3, IL-1RAcP
Reference ARO-P13075
Note For research use only.
Molecular Constructor
Gly65–Asn249
Product name ARO-P13075-50
Uniprot ID Q9NPH3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPN
Molecular weight 23.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly65-Asn249
Aliases /Synonyms IL-1R3, C3orf13, Interleukin-1 receptor 3, Interleukin-1 receptor accessory protein, IL1RAP, IL-1R-3, IL-1 receptor accessory protein, IL1R3, IL-1RAcP
Reference ARO-P13075
Note For research use only.
Molecular Constructor
Gly65–Asn249

Introduction to Recombinant Human IL1RAP

Recombinant Human IL1RAP (Interleukin-1 receptor accessory protein) is a protein that plays a crucial role in the immune response and inflammatory processes. It is a member of the interleukin-1 receptor family and is encoded by the IL1RAP gene. This protein is widely used in scientific research and has potential therapeutic applications in various diseases.

Structure of Recombinant Human IL1RAP

Recombinant Human IL1RAP is a 55 kDa transmembrane protein that consists of 447 amino acids. It contains a signal peptide, an extracellular domain, a transmembrane domain, and a cytoplasmic domain. The extracellular domain is responsible for binding to its ligands, IL-1α and IL-1β, while the cytoplasmic domain is involved in signal transduction. The crystal structure of recombinant human IL1RAP has been determined, revealing a unique fold with a central β-sheet surrounded by α-helices.

Activity of Recombinant Human IL1RAP

Recombinant Human IL1RAP is a co-receptor for the pro-inflammatory cytokines IL-1α and IL-1β. It is essential for the activation of the IL-1 signaling pathway, which plays a crucial role in the immune response and inflammation. The binding of IL-1α or IL-1β to IL1RAP results in the recruitment of the IL-1 receptor type I (IL-1R1), leading to the formation of a signaling complex. This complex then activates downstream signaling pathways, including NF-κB and MAPK, which regulate the expression of pro-inflammatory genes. IL1RAP also interacts with other receptors, such as IL-1R3 and IL-1R8, to modulate the activity of IL-1 signaling.

Application of Recombinant Human IL1RAP

Recombinant Human IL1RAP has various applications in scientific research, including the study of immune response and inflammation. It is also used in the development of therapeutic strategies for diseases associated with dysregulated IL-1 signaling, such as rheumatoid arthritis, inflammatory bowel disease, and sepsis. Recombinant human IL1RAP has been shown to have therapeutic potential in preclinical studies, with promising results in animal models of inflammatory diseases.

Recombinant Human IL1RAP as a recombinant protein

Recombinant Human IL1RAP is produced using recombinant DNA technology, where the IL1RAP gene is inserted into a suitable expression vector and then expressed in a host cell. This results in the production of a pure and biologically active form of IL1RAP that can be used in various research applications. Recombinant human IL1RAP is available from various commercial sources and is widely used in studies investigating the role of IL1RAP in different diseases.

Recombinant Human IL1RAP as an antigen

Recombinant Human IL1RAP can also be used as an antigen in immunological assays, such as ELISA and Western blot, to detect the presence of IL1RAP in biological samples. It is also used in the development of antibodies against IL1RAP for research and diagnostic purposes. The availability of recombinant human IL1RAP has greatly facilitated the study of IL1RAP and its role in various diseases.

Conclusion

Recombinant Human IL1RAP is a crucial protein involved in the immune response and inflammation. Its structure, activity, and applications have been extensively studied, and it has shown potential as a therapeutic target for various diseases. The availability of recombinant human IL1RAP has greatly advanced our understanding of IL1RAP biology and its role in disease pathogenesis. Further research on this protein may lead to the development of novel treatments for inflammatory diseases.</

Recombinant Human IL1RAP, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL1RAP, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products