Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL29/IFNL1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IU54
Molecular weight:
22.32 kDa

Original price was: $315.00.Current price is: $274.00.

50ug 13% OFF + 274 loyalty points
Gly20–Thr200
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL29/IFNL1, N-His

Product name ARO-P13259-100
Uniprot ID Q8IU54
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Molecular weight 22.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Thr200
Aliases /Synonyms ZCYTO21, Cytokine Zcyto21, IFNL1, Interferon lambda-1, IL-29, IFN-lambda-1, Interleukin-29, IL29
Reference ARO-P13259
Note For research use only.
Molecular Constructor
Gly20–Thr200
Product name ARO-P13259-1MG
Uniprot ID Q8IU54
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Molecular weight 22.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Thr200
Aliases /Synonyms ZCYTO21, Cytokine Zcyto21, IFNL1, Interferon lambda-1, IL-29, IFN-lambda-1, Interleukin-29, IL29
Reference ARO-P13259
Note For research use only.
Molecular Constructor
Gly20–Thr200
Product name ARO-P13259-50
Uniprot ID Q8IU54
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Molecular weight 22.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Thr200
Aliases /Synonyms ZCYTO21, Cytokine Zcyto21, IFNL1, Interferon lambda-1, IL-29, IFN-lambda-1, Interleukin-29, IL29
Reference ARO-P13259
Note For research use only.
Molecular Constructor
Gly20–Thr200

Introduction to Recombinant Human IL29/IFNL1

Recombinant Human IL29/IFNL1 is a type III interferon protein that plays a crucial role in the immune response against viral infections. It is a recombinant protein, meaning it is produced through genetic engineering techniques in a laboratory setting. This protein has gained significant attention in the scientific community due to its potent antiviral properties and its potential therapeutic applications. In this article, we will delve into the structure, activity, and applications of Recombinant Human IL29/IFNL1.

Structure of Recombinant Human IL29/IFNL1

Recombinant Human IL29/IFNL1 is a 200 amino acid protein with a molecular weight of approximately 22 kDa. It belongs to the interferon lambda family, which also includes IFNL2 and IFNL3. The protein is composed of a signal peptide, a helical cytokine domain, and a C-terminal extension. The cytokine domain is responsible for the biological activity of IL29/IFNL1, while the C-terminal extension is important for receptor binding.

The crystal structure of Recombinant Human IL29/IFNL1 has been determined, and it shares a similar fold with other type III interferons. The cytokine domain consists of six helices, forming a compact bundle, and a long loop region that is involved in receptor binding. The C-terminal extension is flexible and can adopt different conformations, allowing for interaction with the receptor.

Activity of Recombinant Human IL29/IFNL1

Recombinant Human IL29/IFNL1 is a potent antiviral cytokine that is produced by immune cells in response to viral infections. It exerts its activity by binding to a specific receptor complex, consisting of the IL10 receptor subunit beta (IL10RB) and the IL28 receptor subunit alpha (IL28RA). This receptor complex is expressed on a variety of cell types, including epithelial cells, fibroblasts, and immune cells.

Upon binding to its receptor, Recombinant Human IL29/IFNL1 triggers a signaling cascade that leads to the activation of various antiviral genes. This results in the inhibition of viral replication and the induction of an antiviral state in the infected cells. Additionally, IL29/IFNL1 also modulates the immune response by promoting the production of other cytokines and chemokines, leading to the recruitment and activation of immune cells.

Applications of Recombinant Human IL29/IFNL1

The potent antiviral activity of Recombinant Human IL29/IFNL1 has made it a promising candidate for the treatment of viral infections. It has shown efficacy against a wide range of viruses, including hepatitis C virus, influenza virus, and respiratory syncytial virus. Clinical trials have demonstrated the safety and effectiveness of IL29/IFNL1 in treating chronic hepatitis C, and it is currently being investigated for other viral infections.

In addition to its antiviral properties, Recombinant Human IL29/IFNL1 has also been shown to have immunomodulatory effects. It has been reported to enhance the immune response against tumors, making it a potential candidate for cancer immunotherapy. IL29/IFNL1 has also been shown to have anti-inflammatory effects, indicating its potential use in autoimmune diseases.

Furthermore, Recombinant Human IL29/IFNL1 has been studied for its role in regulating the gut microbiome. It has been shown to modulate the composition of gut bacteria, leading to a beneficial effect on gastrointestinal diseases such as inflammatory bowel disease.

Conclusion

In summary, Recombinant Human IL29/IFNL1 is a potent antiviral cytokine with immunomodulatory properties. Its structure, activity, and applications make it a promising candidate for the treatment of viral infections, cancer, and autoimmune diseases. Further research and clinical trials are needed to fully understand the potential of this protein in various therapeutic areas.

Recombinant Human IL29/IFNL1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL29/IFNL1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products