Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL36B/IL-1F8, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NZH7
Molecular weight:
20.35 kDa

Original price was: $383.00.Current price is: $327.00.

100ug 15% OFF + 327 loyalty points
Arg5–Met164
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL36B/IL-1F8, N-His

Product name ARO-P13052-100
Uniprot ID Q9NZH7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM
Molecular weight 20.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg5-Met164
Aliases /Synonyms Interleukin-1 family member 8, Interleukin-1 homolog 2, IL36B, IL1H2, Interleukin-1 eta, FIL1 eta, IL-1H2, IL-1F8, Interleukin-36 beta, IL1F8, IL-1 eta
Reference ARO-P13052
Note For research use only.
Molecular Constructor
Arg5–Met164
Product name ARO-P13052-1MG
Uniprot ID Q9NZH7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM
Molecular weight 20.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg5-Met164
Aliases /Synonyms Interleukin-1 family member 8, Interleukin-1 homolog 2, IL36B, IL1H2, Interleukin-1 eta, FIL1 eta, IL-1H2, IL-1F8, Interleukin-36 beta, IL1F8, IL-1 eta
Reference ARO-P13052
Note For research use only.
Molecular Constructor
Arg5–Met164
Product name ARO-P13052-50
Uniprot ID Q9NZH7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM
Molecular weight 20.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg5-Met164
Aliases /Synonyms Interleukin-1 family member 8, Interleukin-1 homolog 2, IL36B, IL1H2, Interleukin-1 eta, FIL1 eta, IL-1H2, IL-1F8, Interleukin-36 beta, IL1F8, IL-1 eta
Reference ARO-P13052
Note For research use only.
Molecular Constructor
Arg5–Met164

Introduction to Recombinant Human IL36B/IL-1F8

Recombinant Human IL36B/IL-1F8 is a protein that belongs to the interleukin-1 (IL-1) family and is also known as IL-1F8 or Interleukin-36 beta. It is produced through recombinant DNA technology and has been extensively studied for its structure, activity, and applications in various fields of research. In this article, we will explore the characteristics of this protein and its potential uses.

Structure of Recombinant Human IL36B/IL-1F8

The gene encoding for IL36B is located on chromosome 2 in humans and is composed of 5 exons. The mature form of the protein consists of 157 amino acids with a molecular weight of approximately 18 kDa. It contains a signal peptide at the N-terminus, followed by a pro-domain, and a mature domain. The mature domain is further divided into three subdomains: the N-terminal subdomain, the central subdomain, and the C-terminal subdomain.

The crystal structure of IL36B has been determined and it belongs to the β-trefoil cytokine family, similar to other members of the IL-1 family. It has a three-dimensional structure with three-fold symmetry and each subdomain consists of six antiparallel β-strands arranged in a Greek key motif. The central subdomain is connected to the N-terminal subdomain by a short loop, while the C-terminal subdomain is connected to the central subdomain by a longer loop.

Activity of Recombinant Human IL36B/IL-1F8

IL36B is a pro-inflammatory cytokine that plays a crucial role in the innate immune response. It binds to its receptor, IL-36R, which is expressed on various immune cells such as monocytes, macrophages, and dendritic cells. This binding activates the NF-κB and MAPK signaling pathways, leading to the production of pro-inflammatory cytokines, chemokines, and antimicrobial peptides.

IL36B has been shown to induce the production of IL-6, IL-8, and GM-CSF, which are important mediators of inflammation and immune response. It also promotes the recruitment and activation of immune cells, such as neutrophils and T cells, to the site of infection or injury. Additionally, IL36B has been reported to have a role in skin inflammation and psoriasis, as well as in the development of autoimmune diseases.

Applications of Recombinant Human IL36B/IL-1F8

Recombinant Human IL36B/IL-1F8 has a wide range of potential applications in research and medicine. One of its main uses is as a tool for studying the IL-36 signaling pathway and its role in inflammation and immune response. It can be used in in vitro and in vivo studies to investigate the effects of IL36B on various cell types and its interactions with other cytokines and receptors.

IL36B has also been explored as a potential therapeutic target for inflammatory diseases. Recombinant IL36B can be used to block the activity of IL36B in diseases such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. It can also be used in combination with other cytokines or immunomodulatory agents to modulate the immune response and treat various conditions.

Furthermore, recombinant IL36B has been used in the development of diagnostic tools for inflammatory diseases. It can be used as an antigen in ELISA or other immunoassays to detect the presence of anti-IL36B antibodies in patient samples. This can aid in the diagnosis and monitoring of diseases such as psoriasis and inflammatory bowel disease.

Conclusion

In summary, Recombinant Human IL36B/IL-1F

Recombinant Human IL36B/IL-1F8, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL36B/IL-1F8, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products