Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human INSIG1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O15503
Molecular weight:
22.29 kDa

Original price was: $347.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Pro2–Leu85
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human INSIG1 Protein, N-His-SUMO & C-Strep

Product name ARO-P11733-100
Uniprot ID O15503
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLL
Molecular weight 22.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Leu85
Aliases /Synonyms Insulin-induced gene 1 protein, INSIG1, INSIG-1
Reference ARO-P11733
Note For research use only.
Molecular Constructor
Pro2–Leu85
Product name ARO-P11733-1MG
Uniprot ID O15503
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLL
Molecular weight 22.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Leu85
Aliases /Synonyms Insulin-induced gene 1 protein, INSIG1, INSIG-1
Reference ARO-P11733
Note For research use only.
Molecular Constructor
Pro2–Leu85
Product name ARO-P11733-50
Uniprot ID O15503
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLL
Molecular weight 22.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Leu85
Aliases /Synonyms Insulin-induced gene 1 protein, INSIG1, INSIG-1
Reference ARO-P11733
Note For research use only.
Molecular Constructor
Pro2–Leu85

The Structure and Function of Recombinant Human INSIG1 Protein

Recombinant Human INSIG1 Protein, also known as insulin-induced gene 1 protein, is a key regulator of cholesterol homeostasis in the human body. This protein is encoded by the INSIG1 gene, which is located on chromosome 7. It is a 28-kDa protein that consists of 261 amino acids and is highly conserved among different species, including humans, mice, and rats.

Structure of Recombinant Human INSIG1 Protein

The structure of Recombinant Human INSIG1 Protein is composed of two main domains: the N-terminal domain and the C-terminal domain. The N-terminal domain is responsible for the interaction with other proteins, while the C-terminal domain is involved in the regulation of cholesterol metabolism.

The N-terminal domain of INSIG1 contains a highly conserved motif known as the INSIG1 domain, which is essential for its function. This domain is responsible for the interaction with other proteins, such as the sterol-sensing domain (SSD) of the SREBP cleavage-activating protein (SCAP). This interaction is crucial for the regulation of cholesterol synthesis in the cell.

The C-terminal domain of INSIG1 contains a transmembrane domain, which anchors the protein to the endoplasmic reticulum (ER) membrane. This domain is essential for the proper localization and function of INSIG1 in the cell.

Function of Recombinant Human INSIG1 Protein

The main function of Recombinant Human INSIG1 Protein is to regulate cholesterol homeostasis in the cell. It does so by inhibiting the activation of sterol regulatory element-binding proteins (SREBPs), which are transcription factors that control the expression of genes involved in cholesterol synthesis.

INSIG1 achieves this by interacting with SCAP, which is a key regulator of SREBP activation. When cholesterol levels in the cell are high, INSIG1 binds to SCAP and prevents it from transporting SREBPs to the Golgi apparatus, where they are activated. This results in a decrease in the expression of genes involved in cholesterol synthesis, leading to a decrease in cholesterol levels in the cell.

On the other hand, when cholesterol levels are low, INSIG1 dissociates from SCAP, allowing it to transport SREBPs to the Golgi apparatus, where they are activated. This results in an increase in the expression of genes involved in cholesterol synthesis, leading to an increase in cholesterol levels in the cell.

Applications of Recombinant Human INSIG1 Protein

Recombinant Human INSIG1 Protein has various applications in both research and therapeutic settings. Some of these applications include:

1. Studying cholesterol metabolism

Recombinant Human INSIG1 Protein is a crucial tool for studying cholesterol metabolism in the cell. Its ability to regulate cholesterol synthesis makes it an essential protein for understanding the mechanisms involved in maintaining cholesterol homeostasis.

2. Developing cholesterol-lowering drugs

Due to its role in regulating cholesterol levels, Recombinant Human INSIG1 Protein has potential as a target for developing cholesterol-lowering drugs. By targeting INSIG1, it is possible to modulate cholesterol levels in the body, which can be beneficial for individuals with high cholesterol levels.

3. Treatment of metabolic diseases

INSIG1 has been linked to various metabolic diseases, such as obesity, diabetes, and atherosclerosis. By understanding its function and structure, it may be possible to develop therapies that target INSIG1 for the treatment of these diseases.

4. Production of antibodies

Recombinant Human INSIG1 Protein can also be used to produce antibodies that can be used for research and diagnostic purposes. These antibodies can specifically

Recombinant Human INSIG1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human INSIG1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products