Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ITIH4 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14624
Molecular weight:
28.86 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Gly32–Gly267
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ITIH4 Protein, N-His

Product name ARO-P11645-100
Uniprot ID Q14624
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GIDIYSLTVDSRVSSRFAHTVVTSRVVNRANTVQEATFQMELPKKAFITNFSMIIDGMTYPGIIKEKAEAQAQYSAAVAKGKSAGLVKATGRNMEQFQVSVSVAPNAKITFELVYEELLKRRLGVYELLLKVRPQQLVKHLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQNKTKAHIRFKPTLSQQQKSPEQQETVLDGNLIIRYDVDRAISGGSIQIENGYFVHYFAPEG
Molecular weight 28.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly32-Gly267
Aliases /Synonyms Inter-alpha-trypsin inhibitor family heavy chain-related protein, Inter-alpha-trypsin inhibitor heavy chain H4, PK120, PK-120, Plasma kallikrein sensitive glycoprotein 120, Inter-alpha-inhibitor heavy chain 4, ITIHL1, ITIH4, IHRP, ITI-HC4, ITI heavy chain H4, Gp120
Reference ARO-P11645
Note For research use only.
Molecular Constructor
Gly32–Gly267
Product name ARO-P11645-1MG
Uniprot ID Q14624
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GIDIYSLTVDSRVSSRFAHTVVTSRVVNRANTVQEATFQMELPKKAFITNFSMIIDGMTYPGIIKEKAEAQAQYSAAVAKGKSAGLVKATGRNMEQFQVSVSVAPNAKITFELVYEELLKRRLGVYELLLKVRPQQLVKHLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQNKTKAHIRFKPTLSQQQKSPEQQETVLDGNLIIRYDVDRAISGGSIQIENGYFVHYFAPEG
Molecular weight 28.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly32-Gly267
Aliases /Synonyms Inter-alpha-trypsin inhibitor family heavy chain-related protein, Inter-alpha-trypsin inhibitor heavy chain H4, PK120, PK-120, Plasma kallikrein sensitive glycoprotein 120, Inter-alpha-inhibitor heavy chain 4, ITIHL1, ITIH4, IHRP, ITI-HC4, ITI heavy chain H4, Gp120
Reference ARO-P11645
Note For research use only.
Molecular Constructor
Gly32–Gly267
Product name ARO-P11645-50
Uniprot ID Q14624
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GIDIYSLTVDSRVSSRFAHTVVTSRVVNRANTVQEATFQMELPKKAFITNFSMIIDGMTYPGIIKEKAEAQAQYSAAVAKGKSAGLVKATGRNMEQFQVSVSVAPNAKITFELVYEELLKRRLGVYELLLKVRPQQLVKHLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQNKTKAHIRFKPTLSQQQKSPEQQETVLDGNLIIRYDVDRAISGGSIQIENGYFVHYFAPEG
Molecular weight 28.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly32-Gly267
Aliases /Synonyms Inter-alpha-trypsin inhibitor family heavy chain-related protein, Inter-alpha-trypsin inhibitor heavy chain H4, PK120, PK-120, Plasma kallikrein sensitive glycoprotein 120, Inter-alpha-inhibitor heavy chain 4, ITIHL1, ITIH4, IHRP, ITI-HC4, ITI heavy chain H4, Gp120
Reference ARO-P11645
Note For research use only.
Molecular Constructor
Gly32–Gly267

Introduction

Recombinant Human ITIH4 Protein, also known as Inter-alpha-trypsin inhibitor heavy chain 4, is a protein that is encoded by the ITIH4 gene in humans. It belongs to the inter-alpha-trypsin inhibitor (ITI) family, which plays an important role in the immune response and inflammation process. Recombinant Human ITIH4 Protein is produced through recombinant DNA technology and has a wide range of applications in the fields of research and medicine.

Structure of Recombinant Human ITIH4 Protein

Recombinant Human ITIH4 Protein is a large glycoprotein with a molecular weight of approximately 120 kDa. It is composed of three heavy chains (H1, H2 and H3) and one light chain (L). The heavy chains are linked together by disulfide bonds, while the light chain is attached to the heavy chain H3 by a chondroitin sulfate chain. The structure of Recombinant Human ITIH4 Protein is similar to other members of the ITI family, with a conserved domain known as the “von Willebrand factor type A” (vWFA) domain. This domain is responsible for the interaction with other proteins and plays a crucial role in the function of ITIH4.

Activity of Recombinant Human ITIH4 Protein

Recombinant Human ITIH4 Protein is a versatile protein with various activities. It is involved in the regulation of inflammation and immune response by binding to various cytokines and proteases. It also has the ability to inhibit the activity of serine proteases, which are enzymes involved in the breakdown of proteins. This activity makes Recombinant Human ITIH4 Protein an important inhibitor of tumor growth and metastasis. Moreover, it has been shown to have anti-coagulant and anti-fibrinolytic properties, making it a potential therapeutic agent for blood clotting disorders.

Application of Recombinant Human ITIH4 Protein

Recombinant Human ITIH4 Protein has a wide range of applications in the field of research and medicine. Its ability to regulate inflammation and immune response makes it a valuable tool in studying various diseases such as cancer, autoimmune disorders, and infectious diseases. It has also been used in diagnostic assays to detect the presence of inflammation markers in the body. In the field of medicine, Recombinant Human ITIH4 Protein has shown promising results in the treatment of various diseases. It has been used as a potential therapeutic agent for cancer, as it has been shown to inhibit tumor growth and metastasis. It has also been investigated as a potential treatment for blood clotting disorders, such as hemophilia and thrombosis.

Conclusion

In summary, Recombinant Human ITIH4 Protein is a large glycoprotein with a wide range of activities and applications. Its structure and function make it a valuable tool in understanding and treating various diseases. Through recombinant DNA technology, this protein can be produced in large quantities, making it readily available for research and medical purposes. Further studies on Recombinant Human ITIH4 Protein may lead to the development of new therapies for various diseases, making it an important protein in the field of biotechnology.

Recombinant Human ITIH4 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ITIH4 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products