Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human JPH3/JP-3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WXH2
Molecular weight:
18.04 kDa

Original price was: $415.00.Current price is: $327.00.

100ug 21% OFF + 327 loyalty points
Met1–Ser147
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human JPH3/JP-3 Protein, N-His

Product name ARO-P11507-100
Uniprot ID Q8WXH2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECAGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQS
Molecular weight 18.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser147
Aliases /Synonyms TNRC22, Junctophilin type 3, Junctophilin-3, JP3, JPH3, Trinucleotide repeat-containing gene 22 protein, JP-3
Reference ARO-P11507
Note For research use only.
Molecular Constructor
Met1–Ser147
Product name ARO-P11507-1MG
Uniprot ID Q8WXH2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECAGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQS
Molecular weight 18.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser147
Aliases /Synonyms TNRC22, Junctophilin type 3, Junctophilin-3, JP3, JPH3, Trinucleotide repeat-containing gene 22 protein, JP-3
Reference ARO-P11507
Note For research use only.
Molecular Constructor
Met1–Ser147
Product name ARO-P11507-50
Uniprot ID Q8WXH2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECAGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQS
Molecular weight 18.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser147
Aliases /Synonyms TNRC22, Junctophilin type 3, Junctophilin-3, JP3, JPH3, Trinucleotide repeat-containing gene 22 protein, JP-3
Reference ARO-P11507
Note For research use only.
Molecular Constructor
Met1–Ser147

Introduction

Recombinant Human JPH3/JP-3 Protein is a synthetic version of the human junctophilin-3 (JPH3) protein, which plays a crucial role in the formation and maintenance of junctions between the plasma membrane and the endoplasmic reticulum (ER) in muscle cells. This protein is encoded by the JPH3 gene and is primarily found in skeletal and cardiac muscle cells. Recombinant Human JPH3/JP-3 Protein has been extensively studied for its structure, activity, and potential applications in various fields.

Structure of Recombinant Human JPH3/JP-3 Protein

Recombinant Human JPH3/JP-3 Protein is a 25 kDa protein that consists of 224 amino acids. It has a similar structure to the native JPH3 protein, with a transmembrane domain and a cytoplasmic domain. The transmembrane domain is composed of two hydrophobic regions and is responsible for anchoring the protein to the plasma membrane. The cytoplasmic domain contains a conserved juxtamembrane region and a C-terminal domain, which are involved in protein-protein interactions.

Activity of Recombinant Human JPH3/JP-3 Protein

Recombinant Human JPH3/JP-3 Protein plays a crucial role in the formation and maintenance of junctions between the plasma membrane and the ER in muscle cells. These junctions, known as triads, are essential for the proper functioning of muscle cells. Recombinant Human JPH3/JP-3 Protein acts as a bridge between the plasma membrane and the ER, facilitating the transfer of calcium ions from the ER to the cytoplasm. This process is essential for muscle contraction and relaxation.

Moreover, studies have shown that Recombinant Human JPH3/JP-3 Protein also plays a role in regulating the size and shape of the triads, which affects the efficiency of calcium ion transfer. This protein has also been found to play a role in maintaining the structural integrity of the triads, which is crucial for muscle function.

Applications of Recombinant Human JPH3/JP-3 Protein

Recombinant Human JPH3/JP-3 Protein has a wide range of potential applications in various fields, including medicine, biotechnology, and research. Some of the key applications of this protein are:

1. Medical Applications

Recombinant Human JPH3/JP-3 Protein has shown promising results in the treatment of muscle-related disorders, such as muscular dystrophy and heart failure. Studies have shown that this protein can improve the efficiency of calcium ion transfer in muscle cells, which can help in improving muscle function. Additionally, Recombinant Human JPH3/JP-3 Protein has also been found to have a protective effect on the triads, which may help in preventing muscle damage.

2. Biotechnology Applications

Recombinant Human JPH3/JP-3 Protein can be used in the production of recombinant proteins. The transmembrane domain of this protein can serve as a fusion partner for other proteins, allowing them to be anchored to the plasma membrane. This technique can be used to produce membrane-bound enzymes and receptors, which are essential for various biotechnological processes.

3. Research Applications

Recombinant Human JPH3/JP-3 Protein is a valuable tool for studying the structure and function of triads in muscle cells. It can be used to investigate the role of triads in muscle contraction and relaxation, as well as in various muscle disorders. Moreover, this protein can also be used to study the interactions between different proteins involved in the formation and maintenance of triads.

Conclusion

Recombinant Human JPH3/JP-3 Protein is a synthetic version of the human junctophilin-3 protein, which plays a crucial role in the formation and maintenance of tri

Recombinant Human JPH3/JP-3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human JPH3/JP-3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products