Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KHDRBS1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q07666
Molecular weight:
21.26 kDa

Original price was: $353.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Lys111–Gly276
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KHDRBS1 Protein, N-His

Product name ARO-P11642-100
Uniprot ID Q07666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNG
Molecular weight 21.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys111-Gly276
Aliases /Synonyms p21 Ras GTPase-activating protein-associated p62, GAP-associated tyrosine phosphoprotein p62, KH domain-containing, RNA-binding, signal transduction-associated protein 1, SAM68, p68, Sam68, KHDRBS1, Src-associated in mitosis 68 kDa protein
Reference ARO-P11642
Note For research use only.
Molecular Constructor
Lys111–Gly276
Product name ARO-P11642-1MG
Uniprot ID Q07666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNG
Molecular weight 21.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys111-Gly276
Aliases /Synonyms p21 Ras GTPase-activating protein-associated p62, GAP-associated tyrosine phosphoprotein p62, KH domain-containing, RNA-binding, signal transduction-associated protein 1, SAM68, p68, Sam68, KHDRBS1, Src-associated in mitosis 68 kDa protein
Reference ARO-P11642
Note For research use only.
Molecular Constructor
Lys111–Gly276
Product name ARO-P11642-50
Uniprot ID Q07666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNG
Molecular weight 21.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys111-Gly276
Aliases /Synonyms p21 Ras GTPase-activating protein-associated p62, GAP-associated tyrosine phosphoprotein p62, KH domain-containing, RNA-binding, signal transduction-associated protein 1, SAM68, p68, Sam68, KHDRBS1, Src-associated in mitosis 68 kDa protein
Reference ARO-P11642
Note For research use only.
Molecular Constructor
Lys111–Gly276

Introduction to Recombinant Human KHDRBS1 Protein

Recombinant Human KHDRBS1 Protein, also known as KH domain-containing, RNA-binding, signal transduction-associated protein 1, is a recombinant protein that plays a crucial role in various cellular processes, including RNA metabolism, signal transduction, and cell proliferation. This protein is encoded by the KHDRBS1 gene and is found in high levels in the brain, heart, and skeletal muscle.

Structure of Recombinant Human KHDRBS1 Protein

The recombinant form of KHDRBS1 protein is produced through genetic engineering techniques, where the gene is inserted into a suitable expression vector and expressed in a host cell. The resulting protein is a 38 kDa polypeptide consisting of 344 amino acids. It contains three KH domains, which are RNA-binding domains, and a proline-rich region that is involved in protein-protein interactions.

The three KH domains of KHDRBS1 protein are responsible for its RNA-binding activity, where they recognize specific RNA sequences and regulate their processing and translation. The proline-rich region, on the other hand, is involved in the interaction with other proteins, such as kinases and phosphatases, which regulate the signaling pathways in which KHDRBS1 is involved.

Activity of Recombinant Human KHDRBS1 Protein

Recombinant Human KHDRBS1 Protein has been shown to play a crucial role in various cellular processes, including RNA metabolism, signal transduction, and cell proliferation. It is known to bind to and regulate the processing of various types of RNA, including messenger RNA (mRNA), microRNA (miRNA), and long non-coding RNA (lncRNA).

The RNA-binding activity of KHDRBS1 protein is essential for the regulation of gene expression. It can either enhance or inhibit the translation of specific mRNAs, depending on the RNA sequence it binds to and the presence of other regulatory factors. This makes KHDRBS1 protein a critical player in the control of cellular processes such as cell growth, differentiation, and apoptosis.

In addition to its role in RNA metabolism, KHDRBS1 protein is also involved in signal transduction pathways. It has been shown to interact with various kinases and phosphatases, which regulate the activity of downstream signaling molecules. This suggests that KHDRBS1 protein may act as a signal transducer, transmitting signals from the cell surface to the nucleus, and ultimately influencing gene expression and cellular behavior.

Application of Recombinant Human KHDRBS1 Protein

The unique structure and activity of Recombinant Human KHDRBS1 Protein make it a valuable tool for various research applications. Its RNA-binding activity and role in regulating gene expression make it an essential protein for studying RNA metabolism and its role in cellular processes. It can also be used to investigate the signaling pathways in which it is involved and the mechanisms by which it regulates these pathways.

Furthermore, KHDRBS1 protein has been implicated in various diseases, including cancer, neurodegenerative disorders, and heart disease. Its dysregulation has been linked to the development and progression of these diseases, making it a potential therapeutic target. Recombinant Human KHDRBS1 Protein can be used in drug discovery and development to investigate the role of this protein in disease and to develop potential treatments targeting its activity.

Conclusion

In summary, Recombinant Human KHDRBS1 Protein is a crucial protein involved in various cellular processes, including RNA metabolism, signal transduction, and cell proliferation. Its unique structure and activity make it a valuable tool for studying these processes and their dysregulation in diseases. Further research on this protein may lead to a better understanding of its role in cellular function and the development of potential therapeutic interventions.

Recombinant Human KHDRBS1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KHDRBS1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products