Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KLF7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75840
Molecular weight:
21.38 kDa

Original price was: $406.00.Current price is: $327.00.

100ug 19% OFF + 327 loyalty points
Met1–Ser175
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KLF7 Protein, N-His

Product name ARO-P11963-100
Uniprot ID O75840
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSS
Molecular weight 21.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser175
Aliases /Synonyms Krueppel-like factor 7, UKLF, KLF7, Ubiquitous krueppel-like factor
Reference ARO-P11963
Note For research use only.
Molecular Constructor
Met1–Ser175
Product name ARO-P11963-1MG
Uniprot ID O75840
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSS
Molecular weight 21.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser175
Aliases /Synonyms Krueppel-like factor 7, UKLF, KLF7, Ubiquitous krueppel-like factor
Reference ARO-P11963
Note For research use only.
Molecular Constructor
Met1–Ser175
Product name ARO-P11963-50
Uniprot ID O75840
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSS
Molecular weight 21.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser175
Aliases /Synonyms Krueppel-like factor 7, UKLF, KLF7, Ubiquitous krueppel-like factor
Reference ARO-P11963
Note For research use only.
Molecular Constructor
Met1–Ser175

Introduction to Recombinant Human KLF7 Protein

Recombinant human KLF7 protein is a highly versatile and important protein that plays a crucial role in various cellular processes. It belongs to the Kruppel-like factor (KLF) family of transcription factors, which are known for their ability to regulate gene expression and control cell growth and differentiation. The KLF7 protein is encoded by the KLF7 gene and is expressed in a variety of tissues, including the brain, heart, and skeletal muscle.

Structure of Recombinant Human KLF7 Protein

The recombinant human KLF7 protein is a 330 amino acid long polypeptide with a molecular weight of approximately 37 kDa. It contains a highly conserved DNA-binding domain known as the Cys2/His2 zinc finger domain, which is responsible for its transcriptional regulatory activity. This domain is composed of three zinc finger motifs that interact with specific DNA sequences to activate or repress gene expression. Additionally, the KLF7 protein also has a proline-rich domain and a transactivation domain, both of which are important for its function as a transcription factor.

Activity of Recombinant Human KLF7 Protein

The primary function of recombinant human KLF7 protein is to regulate gene expression by binding to specific DNA sequences and either activating or repressing the transcription of target genes. It has been shown to interact with a wide range of target genes involved in various cellular processes such as cell proliferation, differentiation, and apoptosis. KLF7 has been found to play a critical role in the development and function of many tissues and organs, including the brain, heart, and skeletal muscle.

Studies have also shown that KLF7 can act as a tumor suppressor by inhibiting cell proliferation and inducing cell death in cancer cells. It has been found to be downregulated in various types of cancer, including breast, lung, and colon cancer, suggesting its potential as a therapeutic target for cancer treatment.

Application of Recombinant Human KLF7 Protein

The recombinant human KLF7 protein has a wide range of applications in both basic research and clinical settings. Its ability to regulate gene expression makes it a valuable tool for studying the molecular mechanisms underlying various diseases and cellular processes. It can be used to investigate the role of KLF7 in different tissues and organs, as well as its interaction with other proteins and DNA sequences.

In addition, the recombinant KLF7 protein can also be used in drug discovery and development. Its potential as a tumor suppressor makes it a promising target for cancer therapy. Researchers are currently exploring the use of KLF7 as a therapeutic agent in cancer treatment, either by directly delivering the protein or by modulating its activity through small molecule inhibitors.

Furthermore, recombinant human KLF7 protein can also be used in diagnostic assays as an antigen for detecting KLF7 levels in patient samples. Changes in KLF7 expression have been linked to various diseases, including cancer and neurological disorders, making it a potential biomarker for disease diagnosis and prognosis.

Conclusion

In conclusion, recombinant human KLF7 protein is a versatile and important protein with a wide range of functions and applications. Its role as a transcription factor in regulating gene expression makes it a valuable tool for studying various cellular processes and diseases. With ongoing research and development, the use of recombinant KLF7 protein is expected to expand, providing new insights into its function and potential for therapeutic and diagnostic applications.

Recombinant Human KLF7 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KLF7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products