Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KLK7, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P49862
Molecular weight:
52.05 kDa

Original price was: $339.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
GST Glu23–Arg253
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KLK7, N-GST

Product name ARO-P13680-100
Uniprot ID P49862
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Molecular weight 52.05 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Arg253
Aliases /Synonyms hSCCE, Stratum corneum chymotryptic enzyme, PRSS6, Kallikrein-7, Serine protease 6, hK7, KLK7, SCCE
Reference ARO-P13680
Note For research use only.
Molecular Constructor
GST Glu23–Arg253
Product name ARO-P13680-1MG
Uniprot ID P49862
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Molecular weight 52.05 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Arg253
Aliases /Synonyms hSCCE, Stratum corneum chymotryptic enzyme, PRSS6, Kallikrein-7, Serine protease 6, hK7, KLK7, SCCE
Reference ARO-P13680
Note For research use only.
Molecular Constructor
GST Glu23–Arg253
Product name ARO-P13680-50
Uniprot ID P49862
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Molecular weight 52.05 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Arg253
Aliases /Synonyms hSCCE, Stratum corneum chymotryptic enzyme, PRSS6, Kallikrein-7, Serine protease 6, hK7, KLK7, SCCE
Reference ARO-P13680
Note For research use only.
Molecular Constructor
GST Glu23–Arg253

Recombinant Human KLK7, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human KLK7, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products