Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human LITAF/PIG7/SIMPLE Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99732
Molecular weight:
35.80 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Ile92–Leu161
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human LITAF/PIG7/SIMPLE Protein, N-GST & C-His

Product name ARO-P11524-100
Uniprot ID Q99732
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Molecular weight 35.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile92-Leu161
Aliases /Synonyms Small integral membrane protein of lysosome/late endosome, LITAF, SIMPLE, p53-induced gene 7 protein, LPS-induced TNF-alpha factor, Lipopolysaccharide-induced tumor necrosis factor-alpha factor, PIG7
Reference ARO-P11524
Note For research use only.
Molecular Constructor
Ile92–Leu161
Product name ARO-P11524-1MG
Uniprot ID Q99732
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Molecular weight 35.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile92-Leu161
Aliases /Synonyms Small integral membrane protein of lysosome/late endosome, LITAF, SIMPLE, p53-induced gene 7 protein, LPS-induced TNF-alpha factor, Lipopolysaccharide-induced tumor necrosis factor-alpha factor, PIG7
Reference ARO-P11524
Note For research use only.
Molecular Constructor
Ile92–Leu161
Product name ARO-P11524-50
Uniprot ID Q99732
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Molecular weight 35.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile92-Leu161
Aliases /Synonyms Small integral membrane protein of lysosome/late endosome, LITAF, SIMPLE, p53-induced gene 7 protein, LPS-induced TNF-alpha factor, Lipopolysaccharide-induced tumor necrosis factor-alpha factor, PIG7
Reference ARO-P11524
Note For research use only.
Molecular Constructor
Ile92–Leu161

Introduction

The Recombinant Human LITAF/PIG7/SIMPLE Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein is also known as LPS-induced TNF-alpha factor (LITAF), phosphatidylinositol glycan anchor biosynthesis class F protein (PIG7), and small integral membrane protein of lysosome/late endosome (SIMPLE). It plays a crucial role in various cellular processes and has potential applications in both research and therapeutic fields.

Structure of Recombinant Human LITAF/PIG7/SIMPLE Protein

The Recombinant Human LITAF/PIG7/SIMPLE Protein is a 161 amino acid protein with a molecular weight of approximately 18 kDa. It consists of a single transmembrane domain and a C-terminal domain that contains a LITAF domain. The LITAF domain is responsible for the protein’s ability to bind to lipopolysaccharides (LPS) and regulate the production of pro-inflammatory cytokines.

Activity of Recombinant Human LITAF/PIG7/SIMPLE Protein

The Recombinant Human LITAF/PIG7/SIMPLE Protein is primarily involved in the regulation of immune and inflammatory responses. It is known to activate the NF-kB signaling pathway and induce the production of pro-inflammatory cytokines, such as TNF-alpha and IL-6. This protein also plays a role in the regulation of autophagy, a cellular process that helps maintain cellular homeostasis by degrading damaged or unnecessary components.

In addition to its role in immune and inflammatory responses, the Recombinant Human LITAF/PIG7/SIMPLE Protein has been found to have anti-tumor activity. It has been shown to inhibit the growth of certain cancer cells and induce apoptosis, or programmed cell death, in these cells. This makes it a potential target for cancer therapy.

Application of Recombinant Human LITAF/PIG7/SIMPLE Protein

The Recombinant Human LITAF/PIG7/SIMPLE Protein has a wide range of applications in both research and therapeutic fields. In research, it is commonly used as an antigen in studies related to immune and inflammatory responses, autophagy, and cancer. Its ability to regulate the production of pro-inflammatory cytokines makes it a valuable tool in understanding various diseases and developing potential treatments.

In the therapeutic field, the Recombinant Human LITAF/PIG7/SIMPLE Protein has potential applications in the treatment of inflammatory diseases, such as rheumatoid arthritis and sepsis. It can also be utilized in cancer therapy as a potential anti-tumor agent. Furthermore, this protein has been studied for its potential role in neurodegenerative diseases, such as Alzheimer’s and Parkinson’s disease.

Conclusion

The Recombinant Human LITAF/PIG7/SIMPLE Protein is a biologically active protein with a crucial role in immune and inflammatory responses. Its structure, activity, and potential applications make it a valuable tool in both research and therapeutic fields. With ongoing studies and advancements in recombinant DNA technology, this protein holds promise for future developments in the treatment of various diseases.

Recombinant Human LITAF/PIG7/SIMPLE Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human LITAF/PIG7/SIMPLE Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products