Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MCC Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P23508
Molecular weight:
36.53 kDa

Original price was: $255.00.Current price is: $230.00.

50ug 10% OFF + 230 loyalty points
Leu224–Ser294
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MCC Protein, N-GST & C-His

Product name ARO-P11365-100
Uniprot ID P23508
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQATGPSS
Molecular weight 36.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu224-Ser294
Aliases /Synonyms MCC, Protein MCC, Colorectal mutant cancer protein
Reference ARO-P11365
Note For research use only.
Molecular Constructor
Leu224–Ser294
Product name ARO-P11365-1MG
Uniprot ID P23508
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQATGPSS
Molecular weight 36.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu224-Ser294
Aliases /Synonyms MCC, Protein MCC, Colorectal mutant cancer protein
Reference ARO-P11365
Note For research use only.
Molecular Constructor
Leu224–Ser294
Product name ARO-P11365-50
Uniprot ID P23508
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQATGPSS
Molecular weight 36.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu224-Ser294
Aliases /Synonyms MCC, Protein MCC, Colorectal mutant cancer protein
Reference ARO-P11365
Note For research use only.
Molecular Constructor
Leu224–Ser294

Introduction

Recombinant proteins have become essential tools in various fields of research and medicine due to their ability to mimic natural proteins and perform specific functions. One such protein is the Recombinant Human MCC Protein, which has gained attention for its potential in cancer treatment and immunotherapy. In this article, we will delve into the structure, activity, and application of this protein in detail.

Structure of Recombinant Human MCC Protein

The Recombinant Human MCC Protein is a 39 kDa protein that is composed of 346 amino acids. It is a soluble protein that belongs to the TGF-beta superfamily and is encoded by the MCC gene. The protein consists of a signal peptide, a propeptide, and a mature region. The mature region is further divided into two domains, the N-terminal domain and the C-terminal domain. The N-terminal domain is responsible for the protein’s binding to its receptor, while the C-terminal domain plays a role in its inhibitory activity.

Activity of Recombinant Human MCC Protein

The primary function of the Recombinant Human MCC Protein is to inhibit the activity of the TGF-beta signaling pathway. This pathway plays a crucial role in cell growth, differentiation, and survival. Dysregulation of this pathway has been linked to various diseases, including cancer. The Recombinant Human MCC Protein acts as a tumor suppressor by inhibiting the activity of TGF-beta, thereby preventing uncontrolled cell growth and proliferation.

Moreover, the Recombinant Human MCC Protein has also been found to have anti-inflammatory properties. It can suppress the production of pro-inflammatory cytokines and promote the production of anti-inflammatory cytokines, making it a potential therapeutic agent for inflammatory diseases.

Application of Recombinant Human MCC Protein

The most significant application of Recombinant Human MCC Protein is in cancer treatment. As mentioned earlier, it acts as a tumor suppressor by inhibiting the TGF-beta signaling pathway. This makes it a potential target for cancer therapy, as many types of cancer have been found to have dysregulated TGF-beta signaling. Studies have shown that the Recombinant Human MCC Protein can inhibit the growth and invasion of cancer cells, making it a promising candidate for cancer treatment.

Additionally, the Recombinant Human MCC Protein has also shown potential in immunotherapy. It has been found to enhance the activity of immune cells, such as natural killer cells and T cells, which play a crucial role in fighting cancer. This makes it a potential adjuvant therapy for cancer treatment, as it can enhance the immune response against cancer cells.

Conclusion

The Recombinant Human MCC Protein is a promising protein with diverse applications in research and medicine. Its unique structure and inhibitory activity make it a potential therapeutic agent for cancer and inflammatory diseases. Further studies and clinical trials are needed to fully understand its mechanisms of action and maximize its potential in various applications. However, the Recombinant Human MCC Protein holds great promise in the fight against cancer and other diseases, and its future looks bright.

Recombinant Human MCC Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human MCC Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products