Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MED1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15648
Molecular weight:
26.09 kDa

Original price was: $352.00.Current price is: $271.00.

50ug 23% OFF + 271 loyalty points
His Met1–Thr212
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MED1 Protein, N-His

Product name ARO-P15564-100
Uniprot ID Q15648
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLT
Molecular weight 26.09 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr212
Aliases /Synonyms Activator-recruited cofactor 205 kDa component, DRIP230, TRIP-2, TR-interacting protein 2, CRSP200, Vitamin D receptor-interacting protein complex component DRIP205, ARC205, MED1, Mediator complex subunit 1, PPAR-binding protein, TRAP220, TRIP2, Thyroid hormone receptor-associated protein complex 220 kDa component, PPARGBP, Mediator of RNA polymerase II transcription subunit 1, DRIP205, Trap220, RB18A, CRSP1, Peroxisome proliferator-activated receptor-binding protein, PPARBP, Thyroid receptor-interacting protein 2, p53 regulatory protein RB18A, PBP
Reference ARO-P15564
Note For research use only.
Molecular Constructor
His Met1–Thr212
Product name ARO-P15564-1MG
Uniprot ID Q15648
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLT
Molecular weight 26.09 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr212
Aliases /Synonyms Activator-recruited cofactor 205 kDa component, DRIP230, TRIP-2, TR-interacting protein 2, CRSP200, Vitamin D receptor-interacting protein complex component DRIP205, ARC205, MED1, Mediator complex subunit 1, PPAR-binding protein, TRAP220, TRIP2, Thyroid hormone receptor-associated protein complex 220 kDa component, PPARGBP, Mediator of RNA polymerase II transcription subunit 1, DRIP205, Trap220, RB18A, CRSP1, Peroxisome proliferator-activated receptor-binding protein, PPARBP, Thyroid receptor-interacting protein 2, p53 regulatory protein RB18A, PBP
Reference ARO-P15564
Note For research use only.
Molecular Constructor
His Met1–Thr212
Product name ARO-P15564-50
Uniprot ID Q15648
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLT
Molecular weight 26.09 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr212
Aliases /Synonyms Activator-recruited cofactor 205 kDa component, DRIP230, TRIP-2, TR-interacting protein 2, CRSP200, Vitamin D receptor-interacting protein complex component DRIP205, ARC205, MED1, Mediator complex subunit 1, PPAR-binding protein, TRAP220, TRIP2, Thyroid hormone receptor-associated protein complex 220 kDa component, PPARGBP, Mediator of RNA polymerase II transcription subunit 1, DRIP205, Trap220, RB18A, CRSP1, Peroxisome proliferator-activated receptor-binding protein, PPARBP, Thyroid receptor-interacting protein 2, p53 regulatory protein RB18A, PBP
Reference ARO-P15564
Note For research use only.
Molecular Constructor
His Met1–Thr212

There are no reviews yet.

Be the first to review “Recombinant Human MED1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products