Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MPZL2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O60487
Molecular weight:
15.87 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Ala26–Thr145
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MPZL2 Protein, N-His

Product name ARO-P12216-100
Uniprot ID O60487
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHT
Molecular weight 15.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala26-Thr145
Aliases /Synonyms EVA1, MPZL2, Epithelial V-like antigen 1, EVA, Myelin protein zero-like protein 2
Reference ARO-P12216
Note For research use only.
Molecular Constructor
Ala26–Thr145
Product name ARO-P12216-1MG
Uniprot ID O60487
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHT
Molecular weight 15.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala26-Thr145
Aliases /Synonyms EVA1, MPZL2, Epithelial V-like antigen 1, EVA, Myelin protein zero-like protein 2
Reference ARO-P12216
Note For research use only.
Molecular Constructor
Ala26–Thr145
Product name ARO-P12216-50
Uniprot ID O60487
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHT
Molecular weight 15.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala26-Thr145
Aliases /Synonyms EVA1, MPZL2, Epithelial V-like antigen 1, EVA, Myelin protein zero-like protein 2
Reference ARO-P12216
Note For research use only.
Molecular Constructor
Ala26–Thr145

Introduction to Recombinant Human MPZL2 Protein

Recombinant Human MPZL2 Protein, also known as Myelin Protein Zero-Like 2, is a highly conserved transmembrane protein that plays a crucial role in cell adhesion and signaling. This protein is encoded by the MPZL2 gene and is expressed in various tissues, including the brain, heart, and skin.

Structure of Recombinant Human MPZL2 Protein

Recombinant Human MPZL2 Protein is a type I transmembrane protein that consists of 330 amino acids. It has a molecular weight of approximately 37 kDa and contains a single transmembrane domain and a cytoplasmic tail. The extracellular region of MPZL2 contains two immunoglobulin-like domains, which are important for protein-protein interactions. The cytoplasmic tail contains a conserved tyrosine residue that is involved in signaling pathways.

Activity of Recombinant Human MPZL2 Protein

Recombinant Human MPZL2 Protein is primarily involved in cell adhesion and migration. It is expressed on the surface of various cell types, including neurons, immune cells, and epithelial cells, where it interacts with other cell surface proteins to mediate cell-cell and cell-matrix interactions. MPZL2 has been shown to promote cell adhesion by binding to integrins and other adhesion molecules, such as CD44 and CD151.

In addition to its role in cell adhesion, MPZL2 also plays a role in cell signaling. The cytoplasmic tail of MPZL2 contains a conserved tyrosine residue that can be phosphorylated, leading to the activation of downstream signaling pathways. This includes the activation of the PI3K-Akt and MAPK-ERK pathways, which are involved in cell survival and proliferation.

Application of Recombinant Human MPZL2 Protein

Recombinant Human MPZL2 Protein has a wide range of applications in both research and clinical settings. One major application is in the study of cell adhesion and migration. The recombinant protein can be used to investigate the role of MPZL2 in these processes, as well as to identify potential binding partners and signaling pathways.

MPZL2 has also been implicated in various diseases, including cancer, autoimmune disorders, and neurological disorders. Therefore, the recombinant protein can be used to study the role of MPZL2 in these diseases and potentially develop new therapeutic strategies targeting this protein.

Furthermore, recombinant MPZL2 protein has potential diagnostic and prognostic applications. In cancer, MPZL2 has been shown to be overexpressed in certain types of tumors, and its expression levels have been correlated with disease progression and patient survival. Therefore, measuring MPZL2 levels in patient samples could potentially be used as a biomarker for cancer diagnosis and prognosis.

Antigenic Properties of Recombinant Human MPZL2 Protein

Recombinant Human MPZL2 Protein is a potential antigen that can be used in immunological studies. The extracellular region of MPZL2 contains two immunoglobulin-like domains, which can serve as targets for antibodies. This recombinant protein can be used to generate specific antibodies for the detection and quantification of MPZL2 in various tissues and cell types.

Moreover, MPZL2 has been identified as a potential target for cancer immunotherapy. Its overexpression in certain types of tumors makes it a promising candidate for targeted therapy using monoclonal antibodies or chimeric antigen receptor

Recombinant Human MPZL2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MPZL2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products