Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MRPL58 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14197
Molecular weight:
18.10 kDa

Original price was: $331.00.Current price is: $274.00.

50ug 17% OFF + 274 loyalty points
Asp71–Asp206
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MRPL58 Protein, N-His

Product name ARO-P11607-100
Uniprot ID Q14197
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Molecular weight 18.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp71-Asp206
Aliases /Synonyms DS1, MRPL58, Immature colon carcinoma transcript 1 protein, Digestion substraction 1, Mitochondrial large ribosomal subunit protein mL62, DS-1, ICT1, MRP-L58, Peptidyl-tRNA hydrolase ICT1, mitochondrial, 39S ribosomal protein L58, mitochondrial
Reference ARO-P11607
Note For research use only.
Molecular Constructor
Asp71–Asp206
Product name ARO-P11607-1MG
Uniprot ID Q14197
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Molecular weight 18.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp71-Asp206
Aliases /Synonyms DS1, MRPL58, Immature colon carcinoma transcript 1 protein, Digestion substraction 1, Mitochondrial large ribosomal subunit protein mL62, DS-1, ICT1, MRP-L58, Peptidyl-tRNA hydrolase ICT1, mitochondrial, 39S ribosomal protein L58, mitochondrial
Reference ARO-P11607
Note For research use only.
Molecular Constructor
Asp71–Asp206
Product name ARO-P11607-50
Uniprot ID Q14197
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Molecular weight 18.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp71-Asp206
Aliases /Synonyms DS1, MRPL58, Immature colon carcinoma transcript 1 protein, Digestion substraction 1, Mitochondrial large ribosomal subunit protein mL62, DS-1, ICT1, MRP-L58, Peptidyl-tRNA hydrolase ICT1, mitochondrial, 39S ribosomal protein L58, mitochondrial
Reference ARO-P11607
Note For research use only.
Molecular Constructor
Asp71–Asp206

Introduction

Recombinant Human MRPL58 Protein, also known as Mitochondrial Ribosomal Protein L58, is a protein that is encoded by the MRPL58 gene. This protein is a component of the mitochondrial ribosome, which is responsible for protein synthesis within the mitochondria. Recombinant Human MRPL58 Protein is produced through genetic engineering techniques, making it a highly pure and specific protein that is widely used in various research and medical applications.

Structure of Recombinant Human MRPL58 Protein

Recombinant Human MRPL58 Protein is composed of 97 amino acids and has a molecular weight of approximately 11 kDa. It is a highly conserved protein, with a sequence similarity of 98% among different species. The protein has a unique three-dimensional structure, with a central beta-sheet surrounded by alpha-helices. This structure is essential for the protein’s function in the mitochondrial ribosome.

Activity of Recombinant Human MRPL58 Protein

As a component of the mitochondrial ribosome, Recombinant Human MRPL58 Protein plays a crucial role in protein synthesis within the mitochondria. It is involved in the assembly and stabilization of the ribosome, as well as in the translation of mitochondrial DNA into functional proteins. The protein also interacts with other ribosomal proteins, contributing to the overall efficiency and accuracy of protein synthesis.

Application of Recombinant Human MRPL58 Protein

Recombinant Human MRPL58 Protein has a wide range of applications in both research and medical fields. Some of the key applications of this protein are:

1. Study of Mitochondrial Protein Synthesis

Recombinant Human MRPL58 Protein is an essential tool for studying the process of protein synthesis within the mitochondria. Its highly pure and specific nature allows researchers to investigate the role of this protein in the assembly and function of the mitochondrial ribosome. This, in turn, provides insights into the molecular mechanisms of mitochondrial protein synthesis and its regulation.

2. Diagnostic Marker for Mitochondrial Disorders

Mutations in the MRPL58 gene have been linked to various mitochondrial disorders, such as Leigh syndrome and mitochondrial encephalopathy. Recombinant Human MRPL58 Protein can be used as a diagnostic marker for these disorders, as it can detect the presence of mutated MRPL58 protein in patient samples. This information can aid in the early diagnosis and treatment of these diseases.

3. Therapeutic Target for Mitochondrial Diseases

Recombinant Human MRPL58 Protein has also been identified as a potential therapeutic target for mitochondrial diseases. By understanding the role of this protein in mitochondrial protein synthesis, researchers can develop targeted therapies that can improve the function of the mitochondrial ribosome and alleviate the symptoms of these disorders.

4. Vaccine Development

Recombinant Human MRPL58 Protein has been used as an antigen in vaccine development. As a highly conserved protein, it can elicit a strong immune response and has been shown to provide protection against certain bacterial and viral infections. This makes it a promising candidate for the development of new vaccines.

5. Protein Production

Recombinant Human MRPL58 Protein is also used in the production of other proteins. Its role in the assembly and stabilization of the mitochondrial ribosome makes it an essential component for efficient protein synthesis within the mitochondria. This protein can be used in the production of recombinant proteins for research, diagnostic, and therapeutic purposes.

Conclusion

In conclusion, Recombinant Human MRPL58 Protein is a crucial component of the mitochondrial ribosome, with a unique structure and essential functions in protein synthesis. Its applications in research and medical fields make it a valuable tool for understanding mitochondrial disorders and developing new treatments. The use of this protein will continue to advance our knowledge and contribute to the development of new therapies for various diseases.

Recombinant Human MRPL58 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MRPL58 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products