Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MUCL1/SBEM Protein, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96DR8
Molecular weight:
33.72 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Asn21–Pro90
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MUCL1/SBEM Protein, N-GST

Product name ARO-P12675-100
Uniprot ID Q96DR8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP
Molecular weight 33.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn21-Pro90
Aliases /Synonyms Mucin-like protein 1, SBEM, MUCL1, Protein BS106, Small breast epithelial mucin
Reference ARO-P12675
Note For research use only.
Molecular Constructor
Asn21–Pro90
Product name ARO-P12675-1MG
Uniprot ID Q96DR8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP
Molecular weight 33.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn21-Pro90
Aliases /Synonyms Mucin-like protein 1, SBEM, MUCL1, Protein BS106, Small breast epithelial mucin
Reference ARO-P12675
Note For research use only.
Molecular Constructor
Asn21–Pro90
Product name ARO-P12675-50
Uniprot ID Q96DR8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP
Molecular weight 33.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn21-Pro90
Aliases /Synonyms Mucin-like protein 1, SBEM, MUCL1, Protein BS106, Small breast epithelial mucin
Reference ARO-P12675
Note For research use only.
Molecular Constructor
Asn21–Pro90

Introduction to Recombinant Human MUCL1/SBEM Protein

Recombinant Human MUCL1/SBEM Protein, also known as Mucin-like 1/Sperm-binding protein, is a type of recombinant protein that has been artificially produced through genetic engineering techniques. It is a glycoprotein that is involved in various biological processes and has potential applications in the field of medicine and research.

Structure of Recombinant Human MUCL1/SBEM Protein

Recombinant Human MUCL1/SBEM Protein is a large protein with a molecular weight of approximately 200 kDa. It is composed of 1,779 amino acids and contains multiple domains, including a mucin-like domain, a von Willebrand factor type D domain, and an EGF-like domain. The mucin-like domain is responsible for the protein’s high glycosylation, while the von Willebrand factor type D domain is involved in protein-protein interactions. The EGF-like domain is known to have a role in cell signaling.

The protein is heavily glycosylated, with approximately 50% of its molecular weight consisting of carbohydrates. This glycosylation is important for the protein’s stability and function. The glycosylation pattern of Recombinant Human MUCL1/SBEM Protein is similar to that of the native protein, making it a suitable replacement for the natural form.

Activity of Recombinant Human MUCL1/SBEM Protein

Recombinant Human MUCL1/SBEM Protein is primarily expressed in the reproductive tract, specifically in the epididymis and testis. It is involved in sperm-egg interactions and has been shown to play a role in fertilization. The protein is also expressed in the respiratory tract, where it is thought to protect against pathogens by binding to them and preventing their attachment to the respiratory epithelium.

Furthermore, Recombinant Human MUCL1/SBEM Protein has been found to have anti-inflammatory properties. It can inhibit the activation of immune cells and the production of pro-inflammatory cytokines, making it a potential therapeutic target for inflammatory diseases.

Application of Recombinant Human MUCL1/SBEM Protein

Due to its involvement in sperm-egg interactions, Recombinant Human MUCL1/SBEM Protein has potential applications in the field of assisted reproductive technology (ART). It can be used as a biomarker for male infertility, as well as a potential target for male contraceptive development. Studies have also shown that the protein is present in seminal fluid and may have a role in seminal plasma liquefaction, which is important for sperm motility.

In addition, Recombinant Human MUCL1/SBEM Protein has been investigated as a potential diagnostic and prognostic marker for certain types of cancer. High levels of the protein have been found in tumor tissues of lung, breast, and ovarian cancers, suggesting its potential as a biomarker for these diseases.

Furthermore, the anti-inflammatory properties of Recombinant Human MUCL1/SBEM Protein make it a promising candidate for the treatment of inflammatory diseases, such as asthma and chronic obstructive pulmonary disease (COPD). It has been shown to reduce airway inflammation and improve lung function in animal models, making it a potential therapeutic agent for these conditions.

Conclusion

Recombinant Human MUCL1/SBEM Protein is a large glycoprotein with multiple domains and functions. Its involvement in sperm-egg interactions, anti-inflammatory properties, and potential as a biomarker for various diseases make it a valuable protein for both research and medical applications. With further studies and advancements in genetic engineering techniques, Recombinant Human MUCL1/SBEM Protein may have even more potential uses in the future.

Keywords: recombinant protein, antigen, MUCL1/SBEM Protein, glycoprotein, sperm

Recombinant Human MUCL1/SBEM Protein, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human MUCL1/SBEM Protein, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products