Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MYOG Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P15173
Molecular weight:
22.81 kDa

Original price was: $353.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Leu66–Gln155
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MYOG Protein, N-His-SUMO

Product name ARO-P11980-100
Uniprot ID P15173
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGG
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu66-Gln155
Aliases /Synonyms Myf-4, Myogenin, bHLHc3, BHLHC3, MYOG, MYF4, Myogenic factor 4, Class C basic helix-loop-helix protein 3
Reference ARO-P11980
Note For research use only.
Molecular Constructor
Leu66–Gln155
Product name ARO-P11980-1MG
Uniprot ID P15173
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGG
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu66-Gln155
Aliases /Synonyms Myf-4, Myogenin, bHLHc3, BHLHC3, MYOG, MYF4, Myogenic factor 4, Class C basic helix-loop-helix protein 3
Reference ARO-P11980
Note For research use only.
Molecular Constructor
Leu66–Gln155
Product name ARO-P11980-50
Uniprot ID P15173
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGG
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu66-Gln155
Aliases /Synonyms Myf-4, Myogenin, bHLHc3, BHLHC3, MYOG, MYF4, Myogenic factor 4, Class C basic helix-loop-helix protein 3
Reference ARO-P11980
Note For research use only.
Molecular Constructor
Leu66–Gln155

Title: Introduction to Recombinant Human MYOG Protein

Recombinant Human MYOG Protein, also known as Myogenin, is a key regulatory protein involved in muscle development and regeneration. It belongs to the Myogenic Regulatory Factor (MRF) family and plays a crucial role in skeletal muscle differentiation. In this article, we will explore the structure, activity and applications of Recombinant Human MYOG Protein.

Title: Structure of Recombinant Human MYOG Protein

Recombinant Human MYOG Protein is a 224 amino acid protein with a molecular weight of 25 kDa. It consists of a basic helix-loop-helix (bHLH) domain, a leucine zipper (LZ) domain, and a transcription activation domain (TAD). The bHLH domain is responsible for DNA binding and dimerization, while the LZ domain mediates protein-protein interactions. The TAD is essential for the transcriptional activity of MYOG.

Title: Activity of Recombinant Human MYOG Protein

MYOG is a transcription factor that regulates the expression of genes involved in muscle differentiation. It binds to specific DNA sequences known as E-boxes and recruits other transcription factors to activate gene expression. MYOG also interacts with chromatin remodeling complexes to facilitate the formation of muscle-specific chromatin structures. This results in the activation of genes required for muscle development and regeneration.

Title: Applications of Recombinant Human MYOG Protein

1. Cell Differentiation Studies: Recombinant Human MYOG Protein is widely used in cell differentiation studies to understand the molecular mechanisms involved in muscle development. It can be added to cell culture media to induce myogenic differentiation in myoblasts, leading to the formation of muscle-like cells.

2. Gene Therapy: MYOG has been identified as a potential therapeutic target for muscle disorders such as muscular dystrophy. Recombinant Human MYOG Protein can be used in gene therapy approaches to promote muscle regeneration and repair damaged muscle tissue.

3. Biomarker for Muscle Diseases: MYOG expression is elevated in various muscle diseases, making it a potential biomarker for disease diagnosis and progression. Recombinant Human MYOG Protein can be used in diagnostic tests to detect the levels of MYOG in patient samples.

4. Protein Production: Recombinant Human MYOG Protein can be produced in large quantities using recombinant DNA technology. It is used in the production of proteins for research and therapeutic purposes.

5. Vaccine Development: MYOG has been identified as an antigen in certain types of cancer, making it a potential target for vaccine development. Recombinant Human MYOG Protein can be used to trigger an immune response against cancer cells expressing MYOG.

Title: Conclusion

In conclusion, Recombinant Human MYOG Protein is a crucial protein involved in muscle development and regeneration. Its structure, activity, and applications make it a valuable tool for research and therapeutic purposes. With ongoing studies and advancements in technology, Recombinant Human MYOG Protein holds great potential for the treatment of muscle disorders and other diseases.

Recombinant Human MYOG Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MYOG Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products