Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MYOT Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UBF9
Molecular weight:
23.80 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
His Arg251–Thr441
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MYOT Protein, N-His

Product name ARO-P13727-100
Uniprot ID Q9UBF9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVT
Molecular weight 23.80 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Liquid
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg251-Thr441
Aliases /Synonyms Myotilin, Myofibrillar titin-like Ig domains protein, MYOT, 57 kDa cytoskeletal protein, TTID, Titin immunoglobulin domain protein
Reference ARO-P13727
Note For research use only.
Molecular Constructor
His Arg251–Thr441
Product name ARO-P13727-1MG
Uniprot ID Q9UBF9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVT
Molecular weight 23.80 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Liquid
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg251-Thr441
Aliases /Synonyms Myotilin, Myofibrillar titin-like Ig domains protein, MYOT, 57 kDa cytoskeletal protein, TTID, Titin immunoglobulin domain protein
Reference ARO-P13727
Note For research use only.
Molecular Constructor
His Arg251–Thr441
Product name ARO-P13727-50
Uniprot ID Q9UBF9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVT
Molecular weight 23.80 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Liquid
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg251-Thr441
Aliases /Synonyms Myotilin, Myofibrillar titin-like Ig domains protein, MYOT, 57 kDa cytoskeletal protein, TTID, Titin immunoglobulin domain protein
Reference ARO-P13727
Note For research use only.
Molecular Constructor
His Arg251–Thr441

Recombinant Human MYOT Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MYOT Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products