Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NBN Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O60934
Molecular weight:
15.42 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
Met1–Asp121
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NBN Protein, N-His

Product name ARO-P11845-100
Uniprot ID O60934
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLD
Molecular weight 15.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp121
Aliases /Synonyms Nibrin, P95, NBS1, Cell cycle regulatory protein p95, NBS, Nijmegen breakage syndrome protein 1, NBN
Reference ARO-P11845
Note For research use only.
Molecular Constructor
Met1–Asp121
Product name ARO-P11845-1MG
Uniprot ID O60934
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLD
Molecular weight 15.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp121
Aliases /Synonyms Nibrin, P95, NBS1, Cell cycle regulatory protein p95, NBS, Nijmegen breakage syndrome protein 1, NBN
Reference ARO-P11845
Note For research use only.
Molecular Constructor
Met1–Asp121
Product name ARO-P11845-50
Uniprot ID O60934
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLD
Molecular weight 15.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp121
Aliases /Synonyms Nibrin, P95, NBS1, Cell cycle regulatory protein p95, NBS, Nijmegen breakage syndrome protein 1, NBN
Reference ARO-P11845
Note For research use only.
Molecular Constructor
Met1–Asp121

Introduction to Recombinant Human NBN Protein

Recombinant Human NBN Protein, also known as Nibrin, is a vital protein involved in DNA damage response and repair. It is encoded by the NBN gene located on chromosome 8 in humans. This protein is essential for maintaining genomic stability and preventing the development of various diseases, including cancer. In this article, we will discuss the structure, activity, and application of Recombinant Human NBN Protein.

Structure of Recombinant Human NBN Protein

The NBN gene encodes a 754 amino acid protein with a molecular weight of approximately 95 kDa. The protein consists of several functional domains, including a forkhead-associated (FHA) domain, a breast cancer carboxy-terminal (BRCT) domain, and a Mre11-binding domain. These domains play a crucial role in the protein’s function in DNA damage response and repair.

The FHA domain is responsible for binding to phosphorylated proteins, while the BRCT domain is involved in protein-protein interactions. The Mre11-binding domain allows Recombinant Human NBN Protein to interact with other proteins involved in DNA repair, such as Mre11 and Rad50.

Additionally, Recombinant Human NBN Protein contains several phosphorylation sites, which are crucial for its activation and interaction with other proteins involved in DNA repair pathways.

Activity of Recombinant Human NBN Protein

Recombinant Human NBN Protein is primarily involved in DNA damage response and repair. It plays a crucial role in the cellular response to DNA double-strand breaks (DSBs), which can be caused by various factors, including ionizing radiation, chemicals, and reactive oxygen species.

Upon detection of DSBs, Recombinant Human NBN Protein is activated and recruits other proteins, such as Mre11 and Rad50, to the site of damage. Together, these proteins form a complex known as the MRN complex, which is essential for initiating the DNA damage response and repair process.

Recombinant Human NBN Protein also plays a crucial role in the activation of the tumor suppressor protein p53. This protein is responsible for initiating cell cycle arrest and promoting DNA repair in response to DNA damage. Therefore, Recombinant Human NBN Protein indirectly contributes to the prevention of cancer development.

Application of Recombinant Human NBN Protein

The role of Recombinant Human NBN Protein in DNA damage response and repair makes it a valuable tool in various research and diagnostic applications. One of the most common applications of this protein is in studying the mechanisms of DNA repair and the development of cancer.

Recombinant Human NBN Protein can also be used in diagnostic tests to detect DNA damage caused by various factors, such as radiation exposure or chemical exposure. Additionally, it can be used as a biomarker for certain types of cancer, as mutations in the NBN gene have been linked to an increased risk of developing breast, ovarian, and prostate cancer.

Furthermore, Recombinant Human NBN Protein is being investigated as a potential therapeutic target for cancer treatment. Studies have shown that targeting this protein can sensitize cancer cells to radiation and chemotherapy, making them more susceptible to treatment.

Conclusion

In summary, Recombinant Human NBN Protein is a crucial protein involved in DNA damage response and repair. Its structure, activity, and application make it an essential tool in understanding the mechanisms of DNA repair and the development of cancer. Further research on this protein may lead to new diagnostic and therapeutic approaches for various diseases, including cancer.

Recombinant Human NBN Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NBN Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products