Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NDNF, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TB73
Molecular weight:
37.44 kDa

Original price was: $322.00.Current price is: $274.00.

50ug 15% OFF + 274 loyalty points
Met238–Phe331
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NDNF, N-GST

Product name ARO-P13229-100
Uniprot ID Q8TB73
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMAPKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHVYSRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFVVNINSNMSTAYVGTF
Molecular weight 37.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met238-Phe331
Aliases /Synonyms NDNF, C4orf31, Protein NDNF, Neuron-derived neurotrophic factor
Reference ARO-P13229
Note For research use only.
Molecular Constructor
Met238–Phe331
Product name ARO-P13229-1MG
Uniprot ID Q8TB73
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMAPKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHVYSRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFVVNINSNMSTAYVGTF
Molecular weight 37.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met238-Phe331
Aliases /Synonyms NDNF, C4orf31, Protein NDNF, Neuron-derived neurotrophic factor
Reference ARO-P13229
Note For research use only.
Molecular Constructor
Met238–Phe331
Product name ARO-P13229-50
Uniprot ID Q8TB73
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMAPKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHVYSRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFVVNINSNMSTAYVGTF
Molecular weight 37.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met238-Phe331
Aliases /Synonyms NDNF, C4orf31, Protein NDNF, Neuron-derived neurotrophic factor
Reference ARO-P13229
Note For research use only.
Molecular Constructor
Met238–Phe331

The Structure of Recombinant Human NDNF

Recombinant human NDNF (Neurotrophic Factor-3) is a protein that is produced through genetic engineering techniques, specifically through the use of recombinant DNA technology. It is a member of the neurotrophin family, which are a group of proteins that play important roles in the development and maintenance of the nervous system.

The recombinant human NDNF protein is made up of 119 amino acids and has a molecular weight of 13.5 kDa. It has a similar structure to other neurotrophins, consisting of a characteristic N-terminal region, a cysteine-rich domain, and a C-terminal region. This structure is crucial for its biological activity, as it allows the protein to interact with specific receptors and exert its effects.

The Activity of Recombinant Human NDNF

Recombinant human NDNF has been shown to have neurotrophic activity, meaning it promotes the growth and survival of nerve cells. It specifically acts on neurons in the peripheral nervous system, including sensory and motor neurons.

The activity of recombinant human NDNF is mediated through its interaction with specific receptors, namely TrkC and p75NTR. TrkC is a tyrosine kinase receptor that is responsible for the growth and survival of neurons, while p75NTR is a receptor that can either enhance or inhibit the effects of TrkC.

Studies have shown that recombinant human NDNF can promote the survival and differentiation of sensory neurons, as well as enhance the regeneration of damaged nerve cells. It has also been found to have a protective effect on motor neurons, which are responsible for muscle movement. These findings suggest that recombinant human NDNF has potential therapeutic applications for nerve injuries and neurodegenerative diseases.

The Application of Recombinant Human NDNF

Recombinant human NDNF has been used in various research studies to investigate its potential therapeutic applications. One study showed that it can promote the survival and regeneration of sensory neurons in a rat model of diabetic neuropathy, a common complication of diabetes that can lead to nerve damage.

Another study demonstrated the potential of recombinant human NDNF in treating spinal cord injury. It was found to promote the survival and regeneration of motor neurons in a mouse model of spinal cord injury, leading to improved motor function.

In addition to these potential therapeutic applications, recombinant human NDNF has also been used in basic research to study the mechanisms of nerve cell growth and survival. It has been shown to have a role in promoting the growth of dendrites, which are the branches of nerve cells that receive signals from other cells.

Conclusion

In summary, recombinant human NDNF is a protein that is produced through genetic engineering techniques and belongs to the neurotrophin family. It has a specific structure that allows it to interact with receptors and exert neurotrophic effects on nerve cells. Its potential therapeutic applications include promoting the survival and regeneration of nerve cells in various conditions, such as diabetic neuropathy and spinal cord injury. Further research on recombinant human NDNF may lead to the development of new treatments for nerve injuries and neurodegenerative diseases.

Recombinant Human NDNF, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human NDNF, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products