Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NFIL3 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q16649
Molecular weight:
24.83 kDa

Original price was: $312.00.Current price is: $274.00.

50ug 12% OFF + 274 loyalty points
Glu65–Ser161
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NFIL3 Protein, N-His-SUMO & C-Strep

Product name ARO-P12277-100
Uniprot ID Q16649
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSS
Molecular weight 24.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu65-Ser161
Aliases /Synonyms IL3BP1, Nuclear factor interleukin-3-regulated protein, E4 promoter-binding protein 4, Interleukin-3 promoter transcriptional activator, NFIL3, Interleukin-3-binding protein 1, Transcriptional activator NF-IL3A, E4BP4
Reference ARO-P12277
Note For research use only.
Molecular Constructor
Glu65–Ser161
Product name ARO-P12277-1MG
Uniprot ID Q16649
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSS
Molecular weight 24.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu65-Ser161
Aliases /Synonyms IL3BP1, Nuclear factor interleukin-3-regulated protein, E4 promoter-binding protein 4, Interleukin-3 promoter transcriptional activator, NFIL3, Interleukin-3-binding protein 1, Transcriptional activator NF-IL3A, E4BP4
Reference ARO-P12277
Note For research use only.
Molecular Constructor
Glu65–Ser161
Product name ARO-P12277-50
Uniprot ID Q16649
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSS
Molecular weight 24.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu65-Ser161
Aliases /Synonyms IL3BP1, Nuclear factor interleukin-3-regulated protein, E4 promoter-binding protein 4, Interleukin-3 promoter transcriptional activator, NFIL3, Interleukin-3-binding protein 1, Transcriptional activator NF-IL3A, E4BP4
Reference ARO-P12277
Note For research use only.
Molecular Constructor
Glu65–Ser161

Introduction

Recombinant Human NFIL3 Protein, also known as Nuclear Factor Interleukin 3-regulated protein, is a protein that plays a crucial role in regulating gene expression and immune response. This protein is produced through recombinant DNA technology, allowing for large-scale production and purification for various research and therapeutic applications.

Structure of Recombinant Human NFIL3 Protein

The structure of Recombinant Human NFIL3 Protein consists of 535 amino acids with a molecular weight of approximately 60 kDa. It belongs to the basic leucine zipper (bZIP) family of transcription factors and contains a basic DNA-binding domain and a leucine zipper dimerization domain. These domains allow for the protein to bind to specific DNA sequences and form dimers with other proteins, respectively.

The protein also contains several functional domains, including a transactivation domain, which is responsible for activating gene expression, and a nuclear localization signal, which directs the protein to the nucleus where it can perform its function.

Activity of Recombinant Human NFIL3 Protein

Recombinant Human NFIL3 Protein is a transcription factor that regulates the expression of various genes involved in immune response, cell proliferation, and differentiation. It binds to specific DNA sequences, known as NFIL3 response elements, and activates or represses the transcription of target genes.

One of the key functions of this protein is its role in regulating the differentiation of immune cells, such as T cells, B cells, and natural killer cells. It has been shown to promote the development of regulatory T cells, which play a crucial role in maintaining immune homeostasis and preventing autoimmune diseases.

In addition, Recombinant Human NFIL3 Protein has been found to regulate the production of cytokines, such as interleukin-3 and granulocyte-macrophage colony-stimulating factor, which are essential for the growth and differentiation of immune cells.

Application of Recombinant Human NFIL3 Protein

Recombinant Human NFIL3 Protein has a wide range of applications in both research and therapeutic settings. In research, it is commonly used as a tool to study the role of NFIL3 in gene regulation and immune response. The protein can be used to manipulate the expression of target genes and study the effects on cell function.

In therapeutic applications, Recombinant Human NFIL3 Protein has shown potential in the treatment of autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis. By promoting the development of regulatory T cells, it can help suppress the abnormal immune response that leads to these diseases.

Moreover, this protein has also been studied for its potential in cancer immunotherapy. It has been shown to enhance the anti-tumor activity of immune cells and promote the production of cytokines that can inhibit tumor growth.

Conclusion

In conclusion, Recombinant Human NFIL3 Protein is a crucial regulator of gene expression and immune response. Its structure, activity, and various applications make it a valuable tool for research and a potential therapeutic agent for autoimmune diseases and cancer. With ongoing research, this protein may hold even more promise for future treatments and advancements in the field of immunology.

Recombinant Human NFIL3 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human NFIL3 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products