Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NGB, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NPG2
Molecular weight:
43.77 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Met1–Glu151
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NGB, N-GST

Product name ARO-P13077-100
Uniprot ID Q9NPG2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Molecular weight 43.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu151
Aliases /Synonyms NGB, Neuroglobin
Reference ARO-P13077
Note For research use only.
Molecular Constructor
Met1–Glu151
Product name ARO-P13077-1MG
Uniprot ID Q9NPG2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Molecular weight 43.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu151
Aliases /Synonyms NGB, Neuroglobin
Reference ARO-P13077
Note For research use only.
Molecular Constructor
Met1–Glu151
Product name ARO-P13077-50
Uniprot ID Q9NPG2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Molecular weight 43.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu151
Aliases /Synonyms NGB, Neuroglobin
Reference ARO-P13077
Note For research use only.
Molecular Constructor
Met1–Glu151

The Structure of Recombinant Human NGB

Recombinant Human NGB, also known as Neuroglobin, is a protein that belongs to the globin family. It is a 151 amino acid long protein that is encoded by the NGB gene in humans. The structure of Recombinant Human NGB is similar to that of other globin proteins, such as hemoglobin and myoglobin, which are responsible for oxygen transport in the body. However, unlike these proteins, NGB is predominantly found in the brain and nervous system.

The protein structure of Recombinant Human NGB consists of a single polypeptide chain with a heme group at its center. The heme group is a crucial component of NGB, as it is responsible for binding and transporting oxygen. The heme group is composed of an iron atom surrounded by a porphyrin ring, which gives NGB its characteristic red color. The heme group is essential for NGB’s function as an oxygen carrier in the brain.

The Activity of Recombinant Human NGB

The primary function of Recombinant Human NGB is to bind and transport oxygen in the brain and nervous system. It is highly expressed in brain regions that are responsible for higher cognitive functions, such as learning and memory. NGB has a high affinity for oxygen, which allows it to effectively transport oxygen to areas of the brain that require it the most.

Apart from its role in oxygen transport, Recombinant Human NGB also has neuroprotective properties. Studies have shown that NGB can protect neurons from damage caused by hypoxia, oxidative stress, and other neurotoxic substances. This is due to its ability to scavenge reactive oxygen species and regulate cellular pathways involved in cell death. NGB’s neuroprotective activity makes it a potential therapeutic target for neurodegenerative diseases and brain injuries.

The Application of Recombinant Human NGB

Recombinant Human NGB has various applications in the fields of neuroscience and medicine. Its ability to transport oxygen and protect neurons makes it a promising candidate for the treatment of neurodegenerative diseases, such as Alzheimer’s and Parkinson’s. NGB’s neuroprotective properties also make it a potential treatment for traumatic brain injuries and stroke.

Apart from its therapeutic applications, Recombinant Human NGB also has diagnostic and research applications. Its high expression in the brain and nervous system makes it a useful marker for brain activity and function. NGB levels can be measured in cerebrospinal fluid and blood, providing insights into brain health and function. Furthermore, NGB knockout mice have been used in research to study the role of NGB in brain development and function.

In conclusion, Recombinant Human NGB is a crucial protein in the brain and nervous system with a unique structure and multiple functions. Its ability to transport oxygen and protect neurons makes it a potential therapeutic target for various neurological disorders. Additionally, its use as a diagnostic and research tool further highlights the importance of this protein in understanding brain function and health.

Recombinant Human NGB, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human NGB, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products