Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NKX2-5 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52952
Molecular weight:
35.63 kDa

Original price was: $322.00.Current price is: $274.00.

50ug 15% OFF + 274 loyalty points
Ser146–Gly206
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NKX2-5 Protein, N-GST & C-His

Product name ARO-P12215-100
Uniprot ID P52952
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVG
Molecular weight 35.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser146-Gly206
Aliases /Synonyms NKX2E, CSX, Homeobox protein Nkx-2.5, NKX2.5, NKX2-5, Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E
Reference ARO-P12215
Note For research use only.
Molecular Constructor
Ser146–Gly206
Product name ARO-P12215-1MG
Uniprot ID P52952
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVG
Molecular weight 35.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser146-Gly206
Aliases /Synonyms NKX2E, CSX, Homeobox protein Nkx-2.5, NKX2.5, NKX2-5, Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E
Reference ARO-P12215
Note For research use only.
Molecular Constructor
Ser146–Gly206
Product name ARO-P12215-50
Uniprot ID P52952
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVG
Molecular weight 35.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser146-Gly206
Aliases /Synonyms NKX2E, CSX, Homeobox protein Nkx-2.5, NKX2.5, NKX2-5, Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E
Reference ARO-P12215
Note For research use only.
Molecular Constructor
Ser146–Gly206

Introduction to Recombinant Human NKX2-5 Protein

Recombinant Human NKX2-5 Protein is a synthetic form of the NKX2-5 protein, which is a transcription factor that plays a crucial role in cardiac development and function. This recombinant protein is produced through genetic engineering techniques, where the gene for NKX2-5 is inserted into a host organism, such as bacteria or yeast, to produce large quantities of the protein for research and therapeutic purposes.

Structure of Recombinant Human NKX2-5 Protein

The NKX2-5 protein belongs to the NK-2 family of homeodomain-containing transcription factors. It is composed of 324 amino acids and has a molecular weight of approximately 36 kDa. The recombinant form of this protein is identical to the native form, with the only difference being the absence of post-translational modifications that occur in the human body. This makes it a highly pure and stable protein for use in various scientific applications.

The structure of NKX2-5 protein consists of three domains – the N-terminal domain, the homeodomain, and the C-terminal domain. The N-terminal domain is responsible for protein-protein interactions, while the homeodomain binds to specific DNA sequences to regulate gene expression. The C-terminal domain is involved in transcriptional activation and can also interact with other transcription factors to modulate gene expression.

Activity of Recombinant Human NKX2-5 Protein

The main function of NKX2-5 protein is to regulate the expression of genes involved in cardiac development and function. It is essential for the formation of the heart during embryonic development and also plays a role in maintaining the proper functioning of the heart in adults. NKX2-5 protein has been shown to regulate the expression of genes involved in cardiac muscle contraction, cell proliferation, and differentiation.

Studies have also shown that mutations in the NKX2-5 gene can lead to congenital heart defects, highlighting the importance of this protein in cardiac development. The recombinant form of NKX2-5 protein can be used to study the molecular mechanisms underlying these defects and to develop potential therapeutic interventions.

Applications of Recombinant Human NKX2-5 Protein

Recombinant Human NKX2-5 Protein has a wide range of applications in the field of cardiovascular research. It can be used in in vitro and in vivo studies to investigate the role of NKX2-5 in cardiac development and function. The recombinant protein can also be used to screen for potential drugs that can target NKX2-5 and its downstream pathways for the treatment of heart diseases.

Furthermore, the high purity and stability of recombinant NKX2-5 protein make it an ideal antigen for the development of diagnostic assays for heart diseases. It can also be used as a standard in immunoassays to measure the levels of NKX2-5 in patient samples, providing valuable information for disease diagnosis and prognosis.

In addition to its research and diagnostic applications, recombinant NKX2-5 protein also has therapeutic potential. It can be used in gene therapy to deliver functional NKX2-5 gene to patients with congenital heart defects caused by mutations in the NKX2-5 gene. This approach has shown promising results in preclinical studies and holds great promise for the treatment of these conditions in the future.

Conclusion

Recombinant Human NKX2-5 Protein is a valuable tool in the study of cardiac development and function. Its well-defined structure, activity, and various applications make it an essential protein for researchers and clinicians alike. With ongoing research and advancements in genetic engineering techniques, the potential of recombinant NKX2-5 protein in the field of cardiovascular research and therapy is vast and promising.

Recombinant Human NKX2-5 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human NKX2-5 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products