Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NPHS2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NP85
Molecular weight:
18.78 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
Met222–Pro372
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NPHS2, N-His

Product name ARO-P13080-100
Uniprot ID Q9NP85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEP
Molecular weight 18.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met222-Pro372
Aliases /Synonyms NPHS2, Podocin
Reference ARO-P13080
Note For research use only.
Molecular Constructor
Met222–Pro372
Product name ARO-P13080-1MG
Uniprot ID Q9NP85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEP
Molecular weight 18.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met222-Pro372
Aliases /Synonyms NPHS2, Podocin
Reference ARO-P13080
Note For research use only.
Molecular Constructor
Met222–Pro372
Product name ARO-P13080-50
Uniprot ID Q9NP85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEP
Molecular weight 18.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met222-Pro372
Aliases /Synonyms NPHS2, Podocin
Reference ARO-P13080
Note For research use only.
Molecular Constructor
Met222–Pro372

Introduction to Recombinant Human NPHS2

Recombinant Human NPHS2, also known as Nephrin, is a protein that plays a crucial role in maintaining the structure and function of the glomerular filtration barrier in the kidneys. It is a transmembrane protein that is primarily expressed in the podocytes, specialized cells that form the filtration barrier in the glomeruli of the kidneys. Mutations in the NPHS2 gene have been linked to a rare genetic disorder called congenital nephrotic syndrome, which is characterized by proteinuria and progressive kidney failure. The recombinant form of NPHS2 has been extensively studied and has shown promising potential for therapeutic applications. In this article, we will explore the structure, activity, and applications of Recombinant Human NPHS2.

Structure of Recombinant Human NPHS2

The NPHS2 gene is located on chromosome 1 and encodes for a protein of 1241 amino acids. The recombinant form of NPHS2 is produced using recombinant DNA technology, where the gene is inserted into a suitable expression system, such as bacteria or mammalian cells, to produce large quantities of the protein. The recombinant protein has a molecular weight of approximately 140 kDa and is glycosylated, meaning it has sugar molecules attached to it. This glycosylation is essential for the proper folding and function of the protein.

The structure of NPHS2 consists of several domains, including an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain contains eight Ig-like domains, which are responsible for protein-protein interactions. The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain plays a role in signaling and cytoskeletal organization.

Activity of Recombinant Human NPHS2

NPHS2 is a key component of the glomerular filtration barrier, which is responsible for filtering blood and preventing the loss of important proteins, such as albumin, into the urine. It is involved in the formation and maintenance of the slit diaphragm, a specialized structure that forms the final barrier to protein filtration in the kidneys. NPHS2 interacts with other proteins, such as podocin and CD2AP, to form a complex that is essential for the integrity of the slit diaphragm.

Mutations in the NPHS2 gene can lead to a decrease in NPHS2 expression or function, resulting in a disruption of the slit diaphragm and increased protein leakage into the urine. This can ultimately lead to kidney damage and failure. Recombinant Human NPHS2 has been shown to restore the function of the slit diaphragm in animal models of congenital nephrotic syndrome, making it a potential therapeutic option for this condition.

Applications of Recombinant Human NPHS2

The primary application of Recombinant Human NPHS2 is in the treatment of congenital nephrotic syndrome caused by mutations in the NPHS2 gene. Studies have shown that recombinant NPHS2 can restore the function of the slit diaphragm and reduce proteinuria in animal models of this disease. Clinical trials are currently underway to evaluate the safety and efficacy of recombinant NPHS2 in human patients.

In addition to its potential therapeutic applications, recombinant NPHS2 is also used as an antigen in research studies. Antibodies against NPHS2 are useful tools for studying the structure and function of the slit diaphragm and its role in kidney diseases. Recombinant NPHS2 can also be used to screen for potential drug candidates that target the slit diaphragm and improve its function.

Conclusion

Recombinant Human NPHS2 is a promising protein with important roles in maintaining the structure and function of the glomerular filtration barrier in the kidneys. Its recombinant form has shown potential for therapeutic applications in congenital nephrotic

Recombinant Human NPHS2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NPHS2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products