Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NTN4, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9HB63
Molecular weight:
53.74 kDa

Original price was: $287.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Glu349–His592
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NTN4, N-GST

Product name ARO-P13100-100
Uniprot ID Q9HB63
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EASGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGH
Molecular weight 53.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu349-His592
Aliases /Synonyms Beta-netrin, Hepar-derived netrin-like protein, Netrin-4, NTN4
Reference ARO-P13100
Note For research use only.
Molecular Constructor
Glu349–His592
Product name ARO-P13100-1MG
Uniprot ID Q9HB63
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EASGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGH
Molecular weight 53.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu349-His592
Aliases /Synonyms Beta-netrin, Hepar-derived netrin-like protein, Netrin-4, NTN4
Reference ARO-P13100
Note For research use only.
Molecular Constructor
Glu349–His592
Product name ARO-P13100-50
Uniprot ID Q9HB63
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EASGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGH
Molecular weight 53.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu349-His592
Aliases /Synonyms Beta-netrin, Hepar-derived netrin-like protein, Netrin-4, NTN4
Reference ARO-P13100
Note For research use only.
Molecular Constructor
Glu349–His592

Introduction to Recombinant Human NTN4

Recombinant Human NTN4, also known as Netrin-4, is a protein that plays a crucial role in the development and maintenance of various tissues in the human body. It belongs to the Netrin family of proteins, which are involved in cell migration, axon guidance, and tissue development. Recombinant Human NTN4 is a synthetic version of the naturally occurring protein, produced through genetic engineering techniques. In this article, we will discuss the structure, activity, and application of Recombinant Human NTN4.

Structure of Recombinant Human NTN4

Recombinant Human NTN4 is a 604 amino acid protein with a molecular weight of approximately 68 kDa. It consists of four domains: a laminin G-like domain, an EGF-like domain, a Netrin domain, and a C-terminal domain. The laminin G-like domain is responsible for binding to integrin receptors, while the EGF-like domain is involved in protein-protein interactions. The Netrin domain is the most conserved region of the protein and is responsible for its biological activity. The C-terminal domain is responsible for binding to heparan sulfate proteoglycans, which are found on the cell surface.

Activity of Recombinant Human NTN4

Recombinant Human NTN4 is a multifunctional protein with diverse biological activities. It is primarily known for its role in tissue development and maintenance. Studies have shown that it is involved in the formation of blood vessels, nerves, and skeletal muscle tissue. It also plays a critical role in the development of the central nervous system, including axon guidance and synapse formation.

In addition to its role in tissue development, Recombinant Human NTN4 has been found to have anti-inflammatory and anti-tumor properties. It has been shown to inhibit the growth and migration of cancer cells, making it a potential therapeutic target for cancer treatment. It also has the ability to modulate the immune response, making it a promising candidate for the treatment of autoimmune diseases.

Application of Recombinant Human NTN4

Recombinant Human NTN4 has a wide range of applications in both research and medicine. Due to its role in tissue development and maintenance, it is commonly used in cell culture studies to investigate the mechanisms of tissue formation and regeneration. It is also used in tissue engineering to promote the growth and differentiation of stem cells into specific cell types.

In medicine, Recombinant Human NTN4 has shown promising results in the treatment of various diseases. Its anti-inflammatory and anti-tumor properties make it a potential therapeutic agent for cancer, autoimmune diseases, and other inflammatory conditions. It has also been studied for its potential role in promoting tissue repair and regeneration in patients with spinal cord injuries and other neurological disorders.

Conclusion

In conclusion, Recombinant Human NTN4 is a versatile protein with diverse biological activities. Its structure, consisting of four distinct domains, allows it to interact with various receptors and molecules, making it an essential player in tissue development and maintenance. Its potential therapeutic applications in cancer, autoimmune diseases, and tissue repair make it a promising candidate for future research and development. With continued studies and advancements in genetic engineering techniques, Recombinant Human NTN4 has the potential to revolutionize the treatment of various diseases and contribute to our understanding of tissue development and regeneration.

Recombinant Human NTN4, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human NTN4, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products