Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human P2RX5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q93086
Molecular weight:
32.22 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Lys53–Arg319
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human P2RX5 Protein, N-His

Product name ARO-P11593-100
Uniprot ID Q93086
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIR
Molecular weight 32.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Arg319
Aliases /Synonyms Purinergic receptor, P2X purinoceptor 5, P2RX5, P2X5, ATP receptor
Reference ARO-P11593
Note For research use only.
Molecular Constructor
Lys53–Arg319
Product name ARO-P11593-1MG
Uniprot ID Q93086
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIR
Molecular weight 32.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Arg319
Aliases /Synonyms Purinergic receptor, P2X purinoceptor 5, P2RX5, P2X5, ATP receptor
Reference ARO-P11593
Note For research use only.
Molecular Constructor
Lys53–Arg319
Product name ARO-P11593-50
Uniprot ID Q93086
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIR
Molecular weight 32.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Arg319
Aliases /Synonyms Purinergic receptor, P2X purinoceptor 5, P2RX5, P2X5, ATP receptor
Reference ARO-P11593
Note For research use only.
Molecular Constructor
Lys53–Arg319

Introduction

Recombinant Human P2RX5 Protein, also known as Purinergic Receptor P2X 5, is a member of the purinergic receptor family. It is encoded by the P2RX5 gene and is found on chromosome 17 in humans. This protein is a ligand-gated ion channel, which means it is activated by binding to specific molecules called ligands. The P2RX5 protein is involved in various physiological processes, including cell signaling, immune response, and inflammation.

Structure of Recombinant Human P2RX5 Protein

The P2RX5 protein is composed of 502 amino acids and has a molecular weight of approximately 56 kDa. It is a transmembrane protein, with two transmembrane domains and a large extracellular loop. The extracellular loop contains the binding site for ligands, while the transmembrane domains form the ion channel. The protein also has intracellular N- and C-termini, which are important for regulating its activity.

Activity of Recombinant Human P2RX5 Protein

The main function of P2RX5 protein is to act as a receptor for extracellular ATP (adenosine triphosphate). When ATP binds to the extracellular loop of P2RX5, it causes a conformational change in the protein, leading to the opening of the ion channel. This allows for the influx of cations, such as calcium and sodium, into the cell. This influx of ions is important for various cellular processes, including cell signaling and neurotransmission.

In addition to ATP, P2RX5 can also be activated by other ligands, such as uridine triphosphate (UTP) and dinucleotides. These ligands bind to the protein with varying affinities, leading to different levels of activation. This allows for the regulation of P2RX5 activity in response to different stimuli.

Application of Recombinant Human P2RX5 Protein

Recombinant Human P2RX5 Protein has various applications in both research and medical fields. One of the main applications is in the study of purinergic signaling and its role in different physiological processes. The recombinant protein can be used to investigate the binding of different ligands to P2RX5 and the resulting changes in its activity. This can provide valuable insights into the mechanisms of purinergic signaling and its role in various diseases.

Another important application of recombinant P2RX5 protein is in drug discovery. As P2RX5 is involved in various cellular processes, it has been identified as a potential target for drug development. Recombinant P2RX5 protein can be used in high-throughput screening assays to identify compounds that can modulate its activity. These compounds can then be further developed as potential therapeutics for diseases associated with P2RX5 dysfunction, such as autoimmune disorders and neurological diseases.

Furthermore, recombinant P2RX5 protein can also be used in the development of diagnostic tools for various diseases. As the expression of P2RX5 is altered in certain diseases, such as cancer and inflammatory disorders, it can serve as a biomarker for disease detection and monitoring. Recombinant P2RX5 protein can be used to develop specific antibodies for detecting the protein in patient samples, allowing for early diagnosis and personalized treatment.

Conclusion

In summary, Recombinant Human P2RX5 Protein is a key player in purinergic signaling, with important roles in cell signaling, immune response, and inflammation. Its structure as a ligand-gated ion channel allows for the regulation of its activity by various ligands. The recombinant protein has multiple applications in research and medicine, including the study of purinergic signaling, drug discovery, and disease diagnosis. Further research on P2RX5 and its ligands may provide new insights into its functions and potential therapeutic applications.

Recombinant Human P2RX5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human P2RX5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products