Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PARVB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9HBI1
Molecular weight:
37.40 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
His61–Glu364
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PARVB Protein, N-His

Product name ARO-P11843-100
Uniprot ID Q9HBI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
Molecular weight 37.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His61-Glu364
Aliases /Synonyms Beta-parvin, Affixin, PARVB
Reference ARO-P11843
Note For research use only.
Molecular Constructor
His61–Glu364
Product name ARO-P11843-1MG
Uniprot ID Q9HBI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
Molecular weight 37.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His61-Glu364
Aliases /Synonyms Beta-parvin, Affixin, PARVB
Reference ARO-P11843
Note For research use only.
Molecular Constructor
His61–Glu364
Product name ARO-P11843-50
Uniprot ID Q9HBI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
Molecular weight 37.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His61-Glu364
Aliases /Synonyms Beta-parvin, Affixin, PARVB
Reference ARO-P11843
Note For research use only.
Molecular Constructor
His61–Glu364

Introduction to Recombinant Human PARVB Protein

Recombinant Human PARVB Protein, also known as Prostate Androgen-Regulated Protein, is a type of recombinant protein that plays a crucial role in various cellular processes. This protein is encoded by the PARVB gene and is a member of the parvin family of actin-binding proteins. It is involved in cell adhesion, migration, and signaling, making it an important protein in both normal and disease states. In this article, we will delve into the structure, activity, and applications of Recombinant Human PARVB Protein.

Structure of Recombinant Human PARVB Protein

Recombinant Human PARVB Protein is a 42 kDa protein consisting of 370 amino acids. It is composed of three domains: the N-terminal calponin homology (CH) domain, the central α-helical domain, and the C-terminal SH3 domain. The CH domain is responsible for binding to actin filaments, while the SH3 domain interacts with other proteins involved in cell signaling. The α-helical domain acts as a linker between the CH and SH3 domains, providing structural stability to the protein.

The crystal structure of Recombinant Human PARVB Protein has been determined, revealing a compact and globular shape with a high degree of flexibility. This allows the protein to interact with a variety of binding partners and perform its diverse functions in the cell.

Activity of Recombinant Human PARVB Protein

Recombinant Human PARVB Protein is primarily involved in cell adhesion and migration. It binds to the actin cytoskeleton and regulates its organization, which is essential for cell movement. It also interacts with other proteins, such as integrins and focal adhesion kinase, to form focal adhesions that connect the cell to the extracellular matrix. These interactions are crucial for cell adhesion and migration in processes such as wound healing and tissue development.

In addition to its role in cell adhesion, Recombinant Human PARVB Protein also plays a role in cell signaling. It has been shown to interact with various signaling molecules, including protein kinases and phosphatases, and modulate their activity. This suggests that Recombinant Human PARVB Protein may be involved in regulating important cellular pathways, such as cell proliferation and survival.

Applications of Recombinant Human PARVB Protein

Due to its involvement in various cellular processes, Recombinant Human PARVB Protein has potential applications in both research and medicine. In research, it can be used as a tool to study cell adhesion and migration, as well as the regulation of cell signaling pathways. Recombinant Human PARVB Protein can also be used to screen for potential drugs that target these processes.

In medicine, Recombinant Human PARVB Protein has been implicated in several diseases, including cancer and cardiovascular disease. It has been shown to be upregulated in prostate cancer, making it a potential biomarker for this type of cancer. Additionally, Recombinant Human PARVB Protein has been found to be involved in the development of atherosclerosis, suggesting it may be a therapeutic target for cardiovascular disease.

Furthermore, Recombinant Human PARVB Protein has been used in the development of diagnostic assays for various diseases, such as breast cancer and chronic kidney disease. Its ability to interact with other proteins and modulate their activity makes it a valuable tool for identifying disease biomarkers and potential drug targets.

Conclusion

In summary, Recombinant Human PARVB Protein is a versatile protein involved in cell adhesion, migration, and signaling. Its structure and activity make it an important player in various cellular processes, and its potential applications in research and medicine make it a valuable tool for understanding and treating diseases. Further research on Recombinant Human PARVB Protein is needed to fully understand its functions and potential therapeutic applications.

Recombinant Human PARVB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PARVB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products