Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PCP4 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P48539
Molecular weight:
19.00 kDa

Original price was: $255.00.Current price is: $230.00.

50ug 10% OFF + 230 loyalty points
Ser2–Ser62
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PCP4 Protein, N-His-SUMO

Product name ARO-P11237-100
Uniprot ID P48539
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Molecular weight 19.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser62
Aliases /Synonyms PCP4, Calmodulin regulator protein PCP4, Purkinje cell protein 4, Brain-specific polypeptide PEP-19, PEP19
Reference ARO-P11237
Note For research use only.
Molecular Constructor
Ser2–Ser62
Product name ARO-P11237-1MG
Uniprot ID P48539
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Molecular weight 19.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser62
Aliases /Synonyms PCP4, Calmodulin regulator protein PCP4, Purkinje cell protein 4, Brain-specific polypeptide PEP-19, PEP19
Reference ARO-P11237
Note For research use only.
Molecular Constructor
Ser2–Ser62
Product name ARO-P11237-50
Uniprot ID P48539
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Molecular weight 19.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser62
Aliases /Synonyms PCP4, Calmodulin regulator protein PCP4, Purkinje cell protein 4, Brain-specific polypeptide PEP-19, PEP19
Reference ARO-P11237
Note For research use only.
Molecular Constructor
Ser2–Ser62

Introduction to Recombinant Human PCP4 Protein

Recombinant Human PCP4 Protein, also known as Purkinje cell protein 4 (PCP4), is a protein that is encoded by the PCP4 gene in humans. It is a member of the EF-hand calcium-binding protein family and is primarily expressed in the cerebellum and heart tissues. This protein has been found to play a crucial role in the regulation of calcium signaling and has been implicated in various physiological processes, making it a subject of extensive research in the field of molecular biology and biotechnology.

Structure of Recombinant Human PCP4 Protein

Recombinant Human PCP4 Protein is a 6.7 kDa protein consisting of 62 amino acids. It contains two EF-hand calcium-binding domains, which are characteristic of the EF-hand protein family. These domains are responsible for binding to calcium ions, which enables the protein to participate in calcium signaling pathways.

The crystal structure of Recombinant Human PCP4 Protein has been determined, revealing a compact globular structure with a well-defined hydrophobic core. The two EF-hand domains are connected by a short linker region, which allows for flexibility and conformational changes upon calcium binding. This structural feature is essential for the protein’s function as a calcium sensor.

Activity of Recombinant Human PCP4 Protein

Recombinant Human PCP4 Protein is primarily known for its calcium-binding activity, which is essential for its role in calcium signaling. Upon binding to calcium ions, the protein undergoes a conformational change, leading to the exposure of its hydrophobic surface. This allows for interaction with other proteins and signaling molecules, resulting in the regulation of various cellular processes.

Studies have shown that Recombinant Human PCP4 Protein is involved in the regulation of intracellular calcium levels, which is crucial for maintaining cellular homeostasis. It has also been found to play a role in the regulation of cardiac contractility and heart rate, highlighting its importance in cardiovascular health.

In addition to its calcium-binding activity, Recombinant Human PCP4 Protein has been shown to interact with other proteins, such as actin and myosin, suggesting a potential role in cytoskeletal organization and muscle contraction.

Application of Recombinant Human PCP4 Protein

Recombinant Human PCP4 Protein has a wide range of applications in both research and biotechnology. Its ability to bind to calcium ions and regulate calcium signaling makes it a valuable tool for studying various cellular processes, such as cell proliferation, differentiation, and apoptosis.

In the biotechnology industry, Recombinant Human PCP4 Protein is used in the production of diagnostic kits for the detection of calcium-related diseases. It is also being investigated as a potential therapeutic target for cardiovascular diseases, as well as neurological disorders, given its expression in the cerebellum.

Furthermore, the production of Recombinant Human PCP4 Protein in a recombinant form has allowed for its use in various biotechnological processes, such as protein-protein interaction studies and drug discovery.

Conclusion

In conclusion, Recombinant Human PCP4 Protein is a small but crucial protein involved in the regulation of calcium signaling and various physiological processes. Its structural features, activity, and wide range of applications make it a subject of extensive research in the field of molecular biology and biotechnology. With further studies, Recombinant Human PCP4 Protein has the potential to contribute to the development of new diagnostics and therapeutics for various diseases.

Recombinant Human PCP4 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human PCP4 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products