Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PDCD6IP, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WUM4
Molecular weight:
50.39 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Glu174–Ala383
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PDCD6IP, N-GST

Product name ARO-P13223-100
Uniprot ID Q8WUM4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIA
Molecular weight 50.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu174-Ala383
Aliases /Synonyms ALG-2-interacting protein 1, ALG-2-interacting protein X, Hp95, AIP1, ALIX, KIAA1375, PDCD6IP, Programmed cell death 6-interacting protein, PDCD6-interacting protein
Reference ARO-P13223
Note For research use only.
Molecular Constructor
Glu174–Ala383
Product name ARO-P13223-1MG
Uniprot ID Q8WUM4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIA
Molecular weight 50.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu174-Ala383
Aliases /Synonyms ALG-2-interacting protein 1, ALG-2-interacting protein X, Hp95, AIP1, ALIX, KIAA1375, PDCD6IP, Programmed cell death 6-interacting protein, PDCD6-interacting protein
Reference ARO-P13223
Note For research use only.
Molecular Constructor
Glu174–Ala383
Product name ARO-P13223-50
Uniprot ID Q8WUM4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIA
Molecular weight 50.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu174-Ala383
Aliases /Synonyms ALG-2-interacting protein 1, ALG-2-interacting protein X, Hp95, AIP1, ALIX, KIAA1375, PDCD6IP, Programmed cell death 6-interacting protein, PDCD6-interacting protein
Reference ARO-P13223
Note For research use only.
Molecular Constructor
Glu174–Ala383

Introduction

Recombinant Human PDCD6IP, also known as Programmed Cell Death 6 Interacting Protein (PDCD6IP), is a protein that plays a crucial role in several cellular processes, including apoptosis, cell proliferation, and intracellular signaling. This protein is encoded by the PDCD6IP gene, which is located on chromosome 5 in humans. Recombinant Human PDCD6IP is a synthetic version of the naturally occurring protein, produced through genetic engineering techniques. In this article, we will discuss the structure, activity, and applications of this recombinant protein.

Structure of Recombinant Human PDCD6IP

Recombinant Human PDCD6IP is a 39-kDa protein consisting of 344 amino acids. It contains a highly conserved N-terminal domain, a central coiled-coil domain, and a C-terminal domain. The N-terminal domain is responsible for the interaction with other proteins, while the coiled-coil domain is involved in protein-protein interactions and oligomerization. The C-terminal domain contains a calcium-binding EF-hand motif, which is important for the regulation of PDCD6IP activity.

Activity of Recombinant Human PDCD6IP

Recombinant Human PDCD6IP is a multifunctional protein that is involved in various cellular processes. One of its main functions is the regulation of apoptosis, or programmed cell death. It does so by interacting with the anti-apoptotic protein Bcl-2 and promoting its degradation, leading to the activation of pro-apoptotic proteins and initiation of the apoptotic pathway. PDCD6IP has also been shown to regulate cell proliferation by modulating the activity of the transcription factor c-Myc, which is involved in cell growth and division.

In addition, Recombinant Human PDCD6IP plays a role in intracellular signaling pathways. It acts as a scaffold protein, bringing together various signaling molecules and facilitating their interactions. This is important for the activation of downstream signaling pathways, such as the mitogen-activated protein kinase (MAPK) pathway, which is involved in cell growth and differentiation.

Applications of Recombinant Human PDCD6IP

Due to its diverse functions, Recombinant Human PDCD6IP has a wide range of applications in both basic research and clinical settings. One of its main uses is in the study of apoptosis and cell proliferation. By modulating PDCD6IP expression or activity, researchers can investigate the role of this protein in these processes and its potential as a therapeutic target.

Recombinant Human PDCD6IP has also been used in cancer research, as it has been shown to play a role in tumor growth and progression. In particular, its interaction with Bcl-2 has been linked to drug resistance in cancer cells. By studying the mechanisms of PDCD6IP-mediated apoptosis, researchers may be able to develop new strategies to overcome drug resistance and improve cancer treatment.

In addition, Recombinant Human PDCD6IP has potential applications in the development of diagnostic tools. As it is involved in various signaling pathways, its expression or activity levels may serve as biomarkers for certain diseases. For example, increased PDCD6IP expression has been linked to the development of Alzheimer’s disease, making it a potential biomarker for early detection and monitoring of this neurodegenerative disorder.

Conclusion

Recombinant Human PDCD6IP is a versatile protein with important roles in apoptosis, cell proliferation, and intracellular signaling. Its structure and activity have been extensively studied, and its potential applications in basic research and clinical settings are promising. As research on this protein continues, we may uncover new insights into its functions and potential therapeutic uses.

Recombinant Human PDCD6IP, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human PDCD6IP, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products