Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PEX3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P56589
Molecular weight:
28.18 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Tyr141–Lys373
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PEX3 Protein, N-His

Product name ARO-P11727-100
Uniprot ID P56589
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQLEK
Molecular weight 28.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr141-Lys373
Aliases /Synonyms Peroxin-3, Peroxisomal assembly protein PEX3, Peroxisomal biogenesis factor 3, PEX3
Reference ARO-P11727
Note For research use only.
Molecular Constructor
Tyr141–Lys373
Product name ARO-P11727-1MG
Uniprot ID P56589
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQLEK
Molecular weight 28.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr141-Lys373
Aliases /Synonyms Peroxin-3, Peroxisomal assembly protein PEX3, Peroxisomal biogenesis factor 3, PEX3
Reference ARO-P11727
Note For research use only.
Molecular Constructor
Tyr141–Lys373
Product name ARO-P11727-50
Uniprot ID P56589
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQLEK
Molecular weight 28.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr141-Lys373
Aliases /Synonyms Peroxin-3, Peroxisomal assembly protein PEX3, Peroxisomal biogenesis factor 3, PEX3
Reference ARO-P11727
Note For research use only.
Molecular Constructor
Tyr141–Lys373

Structure of Recombinant Human PEX3 Protein

Recombinant Human PEX3 Protein is a synthetic version of the human PEX3 protein, which is encoded by the PEX3 gene. It is a 42-kDa protein consisting of 374 amino acids. The recombinant protein is produced through genetic engineering techniques, using a host organism such as bacteria or yeast, and is highly purified to ensure its structural and functional integrity.

Activity of Recombinant Human PEX3 Protein

The main function of PEX3 protein is to facilitate the transport of peroxisomal membrane proteins (PMPs) to the peroxisome, a cellular organelle involved in various metabolic processes. Recombinant Human PEX3 Protein has been shown to have the same activity as the native protein, making it a valuable tool for studying the role of PEX3 in peroxisome biogenesis and function.

Studies have also demonstrated that PEX3 plays a crucial role in the maintenance of peroxisome morphology and the formation of peroxisome-retention signals. Recombinant Human PEX3 Protein has been used in research to investigate the mechanisms underlying these processes and their potential implications in peroxisomal disorders.

Application of Recombinant Human PEX3 Protein

Recombinant Human PEX3 Protein has a wide range of applications in both basic and clinical research. It is commonly used as an antigen in antibody production and in the development of diagnostic assays for peroxisomal disorders. The recombinant protein can also be used in various cellular and biochemical assays to study the function of PEX3 and its interactions with other peroxisomal proteins.

Furthermore, Recombinant Human PEX3 Protein has been used in studies to investigate the role of PEX3 in diseases such as Zellweger syndrome, a rare genetic disorder characterized by the absence of functional peroxisomes. These studies have provided valuable insights into the molecular mechanisms underlying this disorder and have the potential to aid in the development of therapeutic strategies.

Conclusion

In summary, Recombinant Human PEX3 Protein is a synthetic version of the human PEX3 protein, produced through genetic engineering techniques. It has the same structure and activity as the native protein and has various applications in scientific research, particularly in the field of peroxisome biology and peroxisomal disorders. Its availability as a purified and highly characterized protein makes it an essential tool for studying the role of PEX3 in cellular processes and its potential implications in disease.

Recombinant Human PEX3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PEX3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products