Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PIDD1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9HB75
Molecular weight:
23.81 kDa

Original price was: $367.00.Current price is: $327.00.

100ug 11% OFF + 327 loyalty points
Phe694–Arg885
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PIDD1, N-His

Product name ARO-P13098-100
Uniprot ID Q9HB75
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIR
Molecular weight 23.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe694-Arg885
Aliases /Synonyms Leucine-rich repeat and death domain-containing protein, PIDD1, p53-induced death domain-containing protein 1, PIDD, LRDD
Reference ARO-P13098
Note For research use only.
Molecular Constructor
Phe694–Arg885
Product name ARO-P13098-1MG
Uniprot ID Q9HB75
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIR
Molecular weight 23.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe694-Arg885
Aliases /Synonyms Leucine-rich repeat and death domain-containing protein, PIDD1, p53-induced death domain-containing protein 1, PIDD, LRDD
Reference ARO-P13098
Note For research use only.
Molecular Constructor
Phe694–Arg885
Product name ARO-P13098-50
Uniprot ID Q9HB75
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIR
Molecular weight 23.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe694-Arg885
Aliases /Synonyms Leucine-rich repeat and death domain-containing protein, PIDD1, p53-induced death domain-containing protein 1, PIDD, LRDD
Reference ARO-P13098
Note For research use only.
Molecular Constructor
Phe694–Arg885

Introduction

Recombinant Human PIDD1 (p53-induced protein with a death domain 1) is a protein that plays a crucial role in regulating cell death and immune responses. It is a member of the death domain-containing protein family and is encoded by the PIDD1 gene. This protein has been extensively studied in recent years due to its potential therapeutic applications in various diseases.

Structure of Recombinant Human PIDD1

Recombinant Human PIDD1 is a 1234 amino acid protein with a molecular weight of approximately 140 kDa. It consists of several domains, including a death domain (DD), a caspase recruitment domain (CARD), and a leucine-rich repeat (LRR) domain. The DD and CARD domains are important for protein-protein interactions, while the LRR domain is involved in protein folding and stability.

Activity of Recombinant Human PIDD1

Recombinant Human PIDD1 is a multifunctional protein with diverse activities. Its main function is to regulate cell death through the activation of caspase-2, a key enzyme in the apoptotic pathway. PIDD1 accomplishes this by forming a complex with two other proteins, RAIDD and PIDDosome, which leads to the activation of caspase-2.

In addition to its role in cell death, PIDD1 also plays a crucial role in regulating immune responses. It has been shown to activate the NF-κB signaling pathway, which is important for the production of pro-inflammatory cytokines and the activation of immune cells. PIDD1 also regulates the production of type I interferons, which are important for antiviral responses.

Application of Recombinant Human PIDD1

The unique structure and activity of Recombinant Human PIDD1 make it a promising candidate for therapeutic applications. Here are some potential applications of this protein:

1. Cancer therapy

Due to its role in regulating cell death, PIDD1 has been studied as a potential target for cancer therapy. Recombinant Human PIDD1 has been shown to induce apoptosis in cancer cells, making it a potential treatment option for various types of cancer. Additionally, PIDD1 has been found to sensitize cancer cells to chemotherapy, making it a potential adjuvant therapy.

2. Anti-inflammatory therapy

The ability of PIDD1 to activate the NF-κB signaling pathway and regulate cytokine production makes it a potential target for anti-inflammatory therapy. Recombinant Human PIDD1 has been shown to reduce inflammation in animal models of inflammatory diseases such as rheumatoid arthritis and colitis.

3. Antiviral therapy

PIDD1 has also been found to play a role in antiviral responses by regulating the production of type I interferons. Recombinant Human PIDD1 has been shown to enhance the immune response against viral infections, making it a potential therapy for viral diseases.

4. Diagnostic tool

Recombinant Human PIDD1 can also be used as a diagnostic tool for certain diseases. For example, elevated levels of PIDD1 have been found in the synovial fluid of patients with rheumatoid arthritis, making it a potential biomarker for this disease. Additionally, PIDD1 has been found to be overexpressed in certain types of cancer, making it a potential diagnostic marker for these cancers.

Conclusion

In conclusion, Recombinant Human PIDD1 is a multifunctional protein with diverse activities, including regulating cell death and immune responses. Its unique structure and activity make it a promising candidate for therapeutic applications in various diseases. Further research on this protein is needed to fully understand its potential and to develop effective treatments based on its functions.

Recombinant Human PIDD1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PIDD1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products