Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PIK3R5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WYR1
Molecular weight:
21.29 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Ala666–Cys838
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PIK3R5 Protein, N-His

Product name ARO-P11841-100
Uniprot ID Q8WYR1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPC
Molecular weight 21.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala666-Cys838
Aliases /Synonyms PIK3R5, Phosphatidylinositol 4,5-bisphosphate 3-kinase regulatory subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, Phosphoinositide 3-kinase regulatory subunit 5, PtdIns-3-kinase p101, p101-PI3K, Protein FOAP-2, PI3-kinase p101 subunit
Reference ARO-P11841
Note For research use only.
Molecular Constructor
Ala666–Cys838
Product name ARO-P11841-1MG
Uniprot ID Q8WYR1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPC
Molecular weight 21.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala666-Cys838
Aliases /Synonyms PIK3R5, Phosphatidylinositol 4,5-bisphosphate 3-kinase regulatory subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, Phosphoinositide 3-kinase regulatory subunit 5, PtdIns-3-kinase p101, p101-PI3K, Protein FOAP-2, PI3-kinase p101 subunit
Reference ARO-P11841
Note For research use only.
Molecular Constructor
Ala666–Cys838
Product name ARO-P11841-50
Uniprot ID Q8WYR1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPC
Molecular weight 21.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala666-Cys838
Aliases /Synonyms PIK3R5, Phosphatidylinositol 4,5-bisphosphate 3-kinase regulatory subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, Phosphoinositide 3-kinase regulatory subunit 5, PtdIns-3-kinase p101, p101-PI3K, Protein FOAP-2, PI3-kinase p101 subunit
Reference ARO-P11841
Note For research use only.
Molecular Constructor
Ala666–Cys838

Introduction to Recombinant Human PIK3R5 Protein

Recombinant Human PIK3R5 Protein, also known as Phosphoinositide-3-kinase regulatory subunit 5, is a protein that plays a crucial role in regulating various cellular processes such as cell growth, proliferation, and survival. This protein is encoded by the PIK3R5 gene and is a member of the phosphoinositide 3-kinase (PI3K) family. Recombinant Human PIK3R5 Protein is produced through recombinant DNA technology, making it a highly pure and bioactive protein for use in research and therapeutic applications.

Structure of Recombinant Human PIK3R5 Protein

Recombinant Human PIK3R5 Protein is a 55 kDa protein that consists of 507 amino acids. It contains several domains, including an SH2 domain, an SH3 domain, and a C-terminal domain. The SH2 domain is responsible for binding to phosphorylated tyrosine residues, while the SH3 domain is involved in protein-protein interactions. The C-terminal domain is important for the regulation of PI3K activity.

Recombinant Human PIK3R5 Protein also has a pleckstrin homology (PH) domain, which is responsible for binding to phosphoinositides, specifically phosphatidylinositol (3,4,5)-trisphosphate (PIP3). This binding results in the recruitment and activation of PI3K, leading to the production of the second messenger, phosphatidylinositol 3,4,5-trisphosphate (PIP3).

Activity of Recombinant Human PIK3R5 Protein

The main function of Recombinant Human PIK3R5 Protein is to regulate the activity of PI3K. PI3K is a key enzyme involved in the PI3K/AKT signaling pathway, which is essential for cell growth, proliferation, and survival. Recombinant Human PIK3R5 Protein acts as a regulatory subunit of PI3K, controlling its activity and specificity. It binds to the catalytic subunit of PI3K, p110, and stabilizes its interaction with PIP3, leading to the activation of PI3K and subsequent downstream signaling.

In addition to its role in PI3K regulation, Recombinant Human PIK3R5 Protein also plays a role in other cellular processes, including cell migration, adhesion, and cytoskeletal rearrangement. It has been shown to interact with several other proteins, such as focal adhesion kinase (FAK), paxillin, and actin, suggesting its involvement in these processes.

Applications of Recombinant Human PIK3R5 Protein

Recombinant Human PIK3R5 Protein has a wide range of applications in both research and therapeutic settings. In research, it is commonly used as a tool to study the PI3K/AKT signaling pathway and its role in various cellular processes. It can also be used to investigate the function of PIK3R5 in different disease states, such as cancer and autoimmune diseases.

In therapeutic applications, Recombinant Human PIK3R5 Protein has shown potential as a target for drug development. Dysregulation of the PI3K/AKT signaling pathway has been implicated in various diseases, including cancer, diabetes, and cardiovascular diseases. By targeting Recombinant Human PIK3R5 Protein, it may be possible to modulate the activity of PI3K and potentially treat these diseases.

Conclusion

Recombinant Human PIK3R5 Protein is a vital protein involved in the regulation of the PI3K/AKT signaling pathway and various cellular processes. Its structure, activity, and applications make it a valuable tool for research and a potential target for drug development. With ongoing research,

Recombinant Human PIK3R5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PIK3R5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products