Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PLA1A, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q53H76
Molecular weight:
18.55 kDa

Original price was: $389.00.Current price is: $327.00.

100ug 16% OFF + 327 loyalty points
Leu309–Lys452
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PLA1A, N-His

Product name ARO-P13312-100
Uniprot ID Q53H76
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLK
Molecular weight 18.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu309-Lys452
Aliases /Synonyms PSPLA1, PS-PLA1, Phosphatidylserine-specific phospholipase A1, PLA1A, NMD, Phospholipase A1 member A
Reference ARO-P13312
Note For research use only.
Molecular Constructor
Leu309–Lys452
Product name ARO-P13312-1MG
Uniprot ID Q53H76
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLK
Molecular weight 18.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu309-Lys452
Aliases /Synonyms PSPLA1, PS-PLA1, Phosphatidylserine-specific phospholipase A1, PLA1A, NMD, Phospholipase A1 member A
Reference ARO-P13312
Note For research use only.
Molecular Constructor
Leu309–Lys452
Product name ARO-P13312-50
Uniprot ID Q53H76
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLK
Molecular weight 18.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu309-Lys452
Aliases /Synonyms PSPLA1, PS-PLA1, Phosphatidylserine-specific phospholipase A1, PLA1A, NMD, Phospholipase A1 member A
Reference ARO-P13312
Note For research use only.
Molecular Constructor
Leu309–Lys452

Introduction

Recombinant Human PLA1A (phospholipase A1A) is a protein that plays a crucial role in lipid metabolism and inflammation. It is a member of the phospholipase A1 (PLA1) family, which catalyzes the hydrolysis of the sn-1 ester bond of glycerophospholipids, generating lysophospholipids and free fatty acids. PLA1A has been extensively studied for its potential therapeutic applications in various diseases, including cardiovascular diseases, cancer, and neurological disorders.

Structure of Recombinant Human PLA1A

Recombinant Human PLA1A is a 32-kDa protein consisting of 296 amino acids. It contains a catalytic domain with a conserved serine residue, which is essential for its enzymatic activity. The protein also has a putative transmembrane domain and a C-terminal domain that is involved in substrate binding. Recombinant PLA1A is produced through recombinant DNA technology, using human PLA1A gene sequence and expression systems such as E. coli or mammalian cells.

Activity of Recombinant Human PLA1A

Recombinant Human PLA1A has been shown to exhibit potent phospholipase A1 activity, specifically targeting phosphatidylcholine and phosphatidylethanolamine. Its activity is calcium-dependent and optimal at neutral pH. PLA1A has been found to be highly specific for the sn-1 ester bond, distinguishing it from other phospholipase enzymes. This unique activity of PLA1A makes it a valuable tool for studying the role of lysophospholipids and free fatty acids in various biological processes.

Application of Recombinant Human PLA1A

1. Cardiovascular diseases: PLA1A has been shown to play a crucial role in atherosclerosis, a major cause of heart attacks and strokes. It has been found to be upregulated in atherosclerotic lesions and is involved in the production of pro-inflammatory mediators. Recombinant Human PLA1A has been used in studies to investigate its potential as a therapeutic target for atherosclerosis. It has also been suggested as a biomarker for early detection of cardiovascular diseases.

2. Cancer: PLA1A has been implicated in the development and progression of various types of cancer, including breast, lung, and colon cancer. It has been found to promote cancer cell proliferation, migration, and invasion. Recombinant Human PLA1A has been used in studies to understand its role in cancer and to develop potential anti-cancer therapies targeting this enzyme.

3. Neurological disorders: PLA1A has been shown to be involved in neuroinflammation and neurodegeneration. It has been found to be upregulated in Alzheimer’s disease and multiple sclerosis. Recombinant Human PLA1A has been used in studies to investigate its role in these diseases and to develop potential treatments.

4. Antibody production: Recombinant Human PLA1A has been used as an antigen to produce antibodies for research purposes. It has been shown to be immunogenic and capable of inducing a specific antibody response in animals. These antibodies have been used to study the expression and localization of PLA1A in various tissues and diseases.

5. Drug discovery: The unique activity of PLA1A makes it a potential target for drug discovery. Recombinant Human PLA1A has been used in high-throughput screening assays to identify small molecule inhibitors of its activity. These inhibitors can be further developed as potential therapeutics for various diseases.

Conclusion

Recombinant Human PLA1A is a promising protein with diverse applications in various fields of research and medicine. Its unique structure and activity make it a valuable tool for studying lipid metabolism and inflammation, as well as a potential target for drug discovery. Further research on PLA1A and its role in various diseases may lead to the development of novel therapies for these conditions.

Recombinant Human PLA1A, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PLA1A, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products