Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PLK3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H4B4
Molecular weight:
27.05 kDa

Original price was: $309.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Thr426–Ala646
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PLK3 Protein, N-His

Product name ARO-P10680-100
Uniprot ID Q9H4B4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA
Molecular weight 27.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr426-Ala646
Aliases /Synonyms FGF-inducible kinase, FNK, PLK-3, Serine/threonine-protein kinase PLK3, Cytokine-inducible serine/threonine-protein kinase, PLK3, PRK, CNK, Polo-like kinase 3, Proliferation-related kinase
Reference ARO-P10680
Note For research use only.
Molecular Constructor
Thr426–Ala646
Product name ARO-P10680-1MG
Uniprot ID Q9H4B4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA
Molecular weight 27.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr426-Ala646
Aliases /Synonyms FGF-inducible kinase, FNK, PLK-3, Serine/threonine-protein kinase PLK3, Cytokine-inducible serine/threonine-protein kinase, PLK3, PRK, CNK, Polo-like kinase 3, Proliferation-related kinase
Reference ARO-P10680
Note For research use only.
Molecular Constructor
Thr426–Ala646
Product name ARO-P10680-50
Uniprot ID Q9H4B4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA
Molecular weight 27.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr426-Ala646
Aliases /Synonyms FGF-inducible kinase, FNK, PLK-3, Serine/threonine-protein kinase PLK3, Cytokine-inducible serine/threonine-protein kinase, PLK3, PRK, CNK, Polo-like kinase 3, Proliferation-related kinase
Reference ARO-P10680
Note For research use only.
Molecular Constructor
Thr426–Ala646

Introduction

Recombinant Human PLK3 protein is a highly sought-after protein in the field of molecular biology and biochemistry. This protein is a member of the Polo-like kinase (PLK) family, which plays a crucial role in cell cycle regulation and cell proliferation. In this article, we will discuss the structure, activity and application of Recombinant Human PLK3 protein.

Structure of Recombinant Human PLK3 Protein

Recombinant Human PLK3 protein is a 68 kDa protein consisting of 603 amino acids. It contains a highly conserved N-terminal kinase domain, a central polo-box domain, and a C-terminal non-catalytic domain. The kinase domain is responsible for the catalytic activity of PLK3, while the polo-box domain is involved in substrate recognition and localization. The non-catalytic domain is responsible for protein-protein interactions and regulation of PLK3 activity.

Activity of Recombinant Human PLK3 Protein

Recombinant Human PLK3 protein is a serine/threonine kinase that is activated during the G2/M phase of the cell cycle. It plays a crucial role in cell cycle progression and cell proliferation by regulating key proteins involved in these processes. PLK3 is known to phosphorylate a variety of substrates, including p53, Cdc25C, and Cdc25B, which are involved in cell cycle checkpoint control and DNA damage response. Additionally, PLK3 has been shown to activate the JNK signaling pathway, which is involved in cell survival and apoptosis.

Application of Recombinant Human PLK3 Protein

Recombinant Human PLK3 protein has a wide range of applications in both research and therapeutic settings. One of the major applications of PLK3 is in cancer research. PLK3 has been shown to be overexpressed in various types of cancer, and its overexpression has been linked to tumor growth and metastasis. Therefore, PLK3 is a potential target for cancer therapy. Recombinant Human PLK3 protein can be used to study the role of PLK3 in cancer and to develop PLK3 inhibitors for cancer treatment.

Another important application of Recombinant Human PLK3 protein is in drug discovery. PLK3 has been identified as a potential target for the treatment of neurodegenerative diseases, such as Alzheimer’s and Parkinson’s disease. Recombinant Human PLK3 protein can be used to screen for potential inhibitors of PLK3, which can then be further developed into drugs for the treatment of these diseases.

Furthermore, Recombinant Human PLK3 protein has been used in various studies to understand its role in cell cycle regulation and cell proliferation. PLK3 knockout studies have shown that this protein is essential for proper cell division and that its absence can lead to genomic instability and cell death. Recombinant Human PLK3 protein can be used to further investigate the mechanisms underlying these processes and to identify potential therapeutic targets for diseases associated with cell cycle dysregulation.

In addition, Recombinant Human PLK3 protein has also been used in the development of diagnostic tools for various diseases. PLK3 has been identified as a potential biomarker for certain types of cancer, and its detection in patient samples can aid in early diagnosis and treatment. Recombinant Human PLK3 protein can be used to develop diagnostic assays for the detection of PLK3 in patient samples.

Conclusion

In summary, Recombinant Human PLK3 protein is a highly versatile protein with a crucial role in cell cycle regulation and cell proliferation. Its structure, activity, and various applications make it a valuable tool for research and therapeutic purposes. Further studies on PLK3 and its potential as a therapeutic target can lead to the development of novel treatments for various diseases.

Recombinant Human PLK3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PLK3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products