Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human POU4F3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15319
Molecular weight:
20.15 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Ser182–His338
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human POU4F3 Protein, N-His

Product name ARO-P12078-100
Uniprot ID Q15319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
Molecular weight 20.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser182-His338
Aliases /Synonyms Brn-3C, Brain-3C, Brain-specific homeobox/POU domain protein 3C, POU4F3, BRN3C, POU domain, class 4, transcription factor 3
Reference ARO-P12078
Note For research use only.
Molecular Constructor
Ser182–His338
Product name ARO-P12078-1MG
Uniprot ID Q15319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
Molecular weight 20.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser182-His338
Aliases /Synonyms Brn-3C, Brain-3C, Brain-specific homeobox/POU domain protein 3C, POU4F3, BRN3C, POU domain, class 4, transcription factor 3
Reference ARO-P12078
Note For research use only.
Molecular Constructor
Ser182–His338
Product name ARO-P12078-50
Uniprot ID Q15319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
Molecular weight 20.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser182-His338
Aliases /Synonyms Brn-3C, Brain-3C, Brain-specific homeobox/POU domain protein 3C, POU4F3, BRN3C, POU domain, class 4, transcription factor 3
Reference ARO-P12078
Note For research use only.
Molecular Constructor
Ser182–His338

Introduction

Recombinant Human POU4F3 Protein, also known as POU domain, class 4, transcription factor 3, is a protein that plays a crucial role in the development and function of the inner ear. This protein is encoded by the POU4F3 gene and is a member of the POU-domain family of transcription factors. In this article, we will discuss the structure, activity, and applications of Recombinant Human POU4F3 Protein.

Structure of Recombinant Human POU4F3 Protein

Recombinant Human POU4F3 Protein is a 343 amino acid long protein with a molecular weight of approximately 36 kDa. It contains a POU-specific domain, a POU homeodomain, and a transactivation domain. The POU-specific domain is responsible for DNA binding, while the POU homeodomain is involved in protein-protein interactions. The transactivation domain is responsible for activating gene expression.

The crystal structure of Recombinant Human POU4F3 Protein has been determined, and it has been found that the protein forms a dimer, with each monomer containing a POU-specific domain and a POU homeodomain. The dimerization of this protein is essential for its activity and is mediated by the POU-specific domain.

Activity of Recombinant Human POU4F3 Protein

Recombinant Human POU4F3 Protein is a transcription factor, which means it binds to specific DNA sequences and regulates the expression of target genes. This protein is primarily expressed in the inner ear, specifically in the hair cells of the cochlea and vestibule. It plays a crucial role in the development and maintenance of these hair cells, which are responsible for converting sound and motion into electrical signals that are sent to the brain.

In addition to its role in the inner ear, Recombinant Human POU4F3 Protein has also been found to play a role in the development of the nervous system. It is involved in the differentiation of neural stem cells into neurons and glial cells. This protein has also been shown to regulate the expression of genes involved in neuronal survival and axon guidance.

Applications of Recombinant Human POU4F3 Protein

Recombinant Human POU4F3 Protein has various applications in the field of research and medicine. One of its main applications is in the study of inner ear development and function. Researchers can use this protein to investigate the role of POU4F3 in the development of hair cells and its contribution to hearing and balance.

In addition, Recombinant Human POU4F3 Protein has potential therapeutic applications. Mutations in the POU4F3 gene have been linked to hearing loss, and studies have shown that introducing functional copies of this gene can restore hearing in animal models. Recombinant Human POU4F3 Protein can be used in gene therapy approaches to treat genetic hearing disorders caused by POU4F3 mutations.

Furthermore, this protein can also be used as an antigen in the development of diagnostic tests for hearing loss. Antibodies against Recombinant Human POU4F3 Protein can be used to detect the presence of this protein in patient samples, which can aid in the diagnosis and monitoring of hearing disorders.

Conclusion

In conclusion, Recombinant Human POU4F3 Protein is a crucial protein involved in the development and function of the inner ear and the nervous system. Its structure, activity, and applications have been extensively studied, and it has shown great potential in the fields of research and medicine. Further studies on this protein may lead to a better understanding of inner ear disorders and the development of novel therapies for hearing loss.

Recombinant Human POU4F3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human POU4F3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products