Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PRKG1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13976
Molecular weight:
36.25 kDa

Original price was: $331.00.Current price is: $274.00.

50ug 17% OFF + 274 loyalty points
Tyr336–Thr631
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PRKG1 Protein, N-His

Product name ARO-P12273-100
Uniprot ID Q13976
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGT
Molecular weight 36.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr336-Thr631
Aliases /Synonyms cGKI, cGMP-dependent protein kinase 1, PRKG1B, PRKGR1B, cGK 1, PRKGR1A, PRKG1, cGK1, cGMP-dependent protein kinase I
Reference ARO-P12273
Note For research use only.
Molecular Constructor
Tyr336–Thr631
Product name ARO-P12273-1MG
Uniprot ID Q13976
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGT
Molecular weight 36.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr336-Thr631
Aliases /Synonyms cGKI, cGMP-dependent protein kinase 1, PRKG1B, PRKGR1B, cGK 1, PRKGR1A, PRKG1, cGK1, cGMP-dependent protein kinase I
Reference ARO-P12273
Note For research use only.
Molecular Constructor
Tyr336–Thr631
Product name ARO-P12273-50
Uniprot ID Q13976
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGT
Molecular weight 36.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr336-Thr631
Aliases /Synonyms cGKI, cGMP-dependent protein kinase 1, PRKG1B, PRKGR1B, cGK 1, PRKGR1A, PRKG1, cGK1, cGMP-dependent protein kinase I
Reference ARO-P12273
Note For research use only.
Molecular Constructor
Tyr336–Thr631

Introduction to Recombinant Human PRKG1 Protein

Recombinant Human PRKG1 Protein, also known as cGMP-dependent protein kinase 1, is a crucial enzyme involved in various biological processes such as smooth muscle relaxation, platelet activation, and regulation of cell growth and differentiation. This protein is encoded by the PRKG1 gene and is a member of the protein kinase family. Recombinant Human PRKG1 Protein is produced through the process of recombinant DNA technology, making it a valuable tool for research and therapeutic applications.

Structure of Recombinant Human PRKG1 Protein

Recombinant Human PRKG1 Protein is a 78 kDa protein composed of 671 amino acids. It consists of three major domains: the N-terminal regulatory domain, the catalytic domain, and the C-terminal autoinhibitory domain. The regulatory domain contains two tandem cGMP-binding domains that are responsible for the activation of the protein. The catalytic domain contains the kinase activity of the protein, and the autoinhibitory domain regulates the kinase activity by interacting with the catalytic domain.

The structure of Recombinant Human PRKG1 Protein is highly conserved among different species, with 99% sequence identity between human and mouse PRKG1 proteins. This high level of conservation highlights the importance of this protein in various biological processes.

Activity of Recombinant Human PRKG1 Protein

Recombinant Human PRKG1 Protein is a serine/threonine kinase that is activated by the binding of cGMP to its regulatory domains. Upon activation, the protein phosphorylates its target proteins, leading to changes in their activity and function. One of the key targets of Recombinant Human PRKG1 Protein is myosin light chain, which is involved in smooth muscle relaxation.

Recombinant Human PRKG1 Protein also plays a crucial role in platelet activation and aggregation. It phosphorylates vasodilator-stimulated phosphoprotein (VASP), which regulates the assembly of actin filaments and controls the shape change and spreading of platelets. This process is essential for proper platelet aggregation and clot formation.

Moreover, Recombinant Human PRKG1 Protein has been shown to regulate cell growth and differentiation by modulating the activity of various transcription factors and signaling pathways. It has been implicated in the development of several diseases, including hypertension, cardiovascular diseases, and cancer.

Application of Recombinant Human PRKG1 Protein

Recombinant Human PRKG1 Protein has a wide range of applications in both research and therapeutic settings. In research, it is used to study the role of PRKG1 in different biological processes and to identify its target proteins. Recombinant Human PRKG1 Protein is also used in drug discovery and development, as it can be used to screen potential inhibitors or activators of the protein.

In the therapeutic field, Recombinant Human PRKG1 Protein has shown promising results in the treatment of cardiovascular diseases. It has been used as a potential therapy for pulmonary hypertension, a condition characterized by high blood pressure in the arteries of the lungs. Recombinant Human PRKG1 Protein has also been studied for its potential anti-cancer effects, as it has been shown to inhibit the growth and metastasis of certain types of cancer cells.

Conclusion

Recombinant Human PRKG1 Protein is a key enzyme involved in various biological processes, making it a valuable tool for research and therapeutic applications. Its structure, activity, and applications have been extensively studied, and it continues to be a subject of interest for scientists and researchers. With its potential to treat various diseases, Recombinant Human PRKG1 Protein holds great promise for future medical advancements.

Recombinant Human PRKG1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PRKG1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products