Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PSMB1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P20618
Molecular weight:
24.78 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Gly38–Asp241
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PSMB1 Protein, N-His

Product name ARO-P12210-100
Uniprot ID P20618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Molecular weight 24.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly38-Asp241
Aliases /Synonyms PSMB1, Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome gamma chain, Proteasome subunit beta type-1, PSC5, Proteasome component C5
Reference ARO-P12210
Note For research use only.
Molecular Constructor
Gly38–Asp241
Product name ARO-P12210-1MG
Uniprot ID P20618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Molecular weight 24.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly38-Asp241
Aliases /Synonyms PSMB1, Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome gamma chain, Proteasome subunit beta type-1, PSC5, Proteasome component C5
Reference ARO-P12210
Note For research use only.
Molecular Constructor
Gly38–Asp241
Product name ARO-P12210-50
Uniprot ID P20618
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Molecular weight 24.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly38-Asp241
Aliases /Synonyms PSMB1, Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome gamma chain, Proteasome subunit beta type-1, PSC5, Proteasome component C5
Reference ARO-P12210
Note For research use only.
Molecular Constructor
Gly38–Asp241

Introduction
Recombinant Human PSMB1 Protein, also known as Proteasome Subunit Beta Type-1, is a protein that plays a crucial role in the degradation of intracellular proteins. This protein is a key component of the proteasome, a large protein complex responsible for the breakdown of damaged or unnecessary proteins in the cell. In this article, we will explore the structure, activity, and application of Recombinant Human PSMB1 Protein.

Structure of Recombinant Human PSMB1 Protein
The PSMB1 gene encodes for the beta 1 subunit of the 20S proteasome, which is composed of two outer alpha rings and two inner beta rings. Each beta ring contains seven different subunits, including PSMB1. The Recombinant Human PSMB1 Protein is a 28 kDa protein consisting of 241 amino acids. It has a globular structure with a central pore that allows entry of the substrate for degradation. This protein also contains a catalytic triad, consisting of Thr1, Asp17, and Lys33, which is essential for its proteolytic activity.

Activity of Recombinant Human PSMB1 Protein
Recombinant Human PSMB1 Protein is a key component of the proteasome and is involved in the degradation of proteins that are marked for destruction by ubiquitin. It specifically cleaves peptide bonds after acidic residues, contributing to the overall proteolytic activity of the proteasome. This protein also plays a crucial role in the regulation of various cellular processes, such as cell cycle progression, DNA repair, and apoptosis. Additionally, Recombinant Human PSMB1 Protein is involved in the processing of antigens for presentation to the immune system, making it an important player in the adaptive immune response.

Application of Recombinant Human PSMB1 Protein
Recombinant Human PSMB1 Protein has various applications in both research and therapeutic settings. In research, this protein is used as a tool to study the structure and function of the proteasome and its role in cellular processes. It is also used in drug discovery and development, as the proteasome is a target for many diseases, including cancer and neurodegenerative disorders. Recombinant Human PSMB1 Protein is also used in the production of monoclonal antibodies, as it is involved in the processing of antigens for presentation to immune cells.

In the therapeutic setting, Recombinant Human PSMB1 Protein has potential applications in cancer treatment. Proteasome inhibitors, such as bortezomib and carfilzomib, have been approved for the treatment of multiple myeloma and other types of cancer. These drugs work by inhibiting the activity of the proteasome, leading to the accumulation of damaged proteins and ultimately inducing cell death. Recombinant Human PSMB1 Protein is also being studied as a potential therapeutic target for autoimmune diseases, as it is involved in the regulation of the immune response.

Conclusion
In summary, Recombinant Human PSMB1 Protein is a key component of the proteasome and plays a crucial role in the degradation of intracellular proteins. Its structure and activity make it an essential player in various cellular processes, including antigen processing and immune response regulation. This protein has multiple applications in research and therapeutics, making it a valuable tool in the study and treatment of diseases. Further research on Recombinant Human PSMB1 Protein may lead to new insights and potential treatments for various disorders.

Recombinant Human PSMB1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PSMB1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products