Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PSPH Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P78330
Molecular weight:
27.17 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Met1–Glu225
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PSPH Protein, N-His

Product name ARO-P12441-100
Uniprot ID P78330
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Molecular weight 27.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu225
Aliases /Synonyms O-phosphoserine phosphohydrolase, Phosphoserine phosphatase, L-3-phosphoserine phosphatase, PSP, PSPH, PSPase
Reference ARO-P12441
Note For research use only.
Molecular Constructor
Met1–Glu225
Product name ARO-P12441-1MG
Uniprot ID P78330
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Molecular weight 27.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu225
Aliases /Synonyms O-phosphoserine phosphohydrolase, Phosphoserine phosphatase, L-3-phosphoserine phosphatase, PSP, PSPH, PSPase
Reference ARO-P12441
Note For research use only.
Molecular Constructor
Met1–Glu225
Product name ARO-P12441-50
Uniprot ID P78330
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Molecular weight 27.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu225
Aliases /Synonyms O-phosphoserine phosphohydrolase, Phosphoserine phosphatase, L-3-phosphoserine phosphatase, PSP, PSPH, PSPase
Reference ARO-P12441
Note For research use only.
Molecular Constructor
Met1–Glu225

Title: Introduction to Recombinant Human PSPH Protein

Recombinant Human PSPH Protein, also known as phosphoserine phosphatase, is an enzyme that plays a crucial role in the biosynthesis of serine, an essential amino acid. This protein is encoded by the PSPH gene and is highly conserved across different species, highlighting its importance in cellular processes. In this article, we will explore the structure, activity, and various applications of recombinant human PSPH protein.

Title: Structure of Recombinant Human PSPH Protein

Recombinant Human PSPH Protein is a homodimer, meaning it is composed of two identical subunits. Each subunit consists of 266 amino acids and has a molecular weight of approximately 29 kDa. The crystal structure of recombinant human PSPH protein has been determined, revealing a 3D structure with a central β-sheet surrounded by α-helices. This unique structure allows the protein to efficiently catalyze the dephosphorylation of phosphoserine.

Title: Activity of Recombinant Human PSPH Protein

Recombinant Human PSPH Protein is a key enzyme in the L-serine biosynthetic pathway, which is essential for the production of proteins, nucleotides, and other important molecules in the body. This enzyme catalyzes the dephosphorylation of phosphoserine to produce L-serine, a process that is crucial for maintaining adequate levels of this amino acid in the body. L-serine is involved in various cellular processes, including protein synthesis, cell signaling, and neurotransmitter production.

Title: Applications of Recombinant Human PSPH Protein

1. Production of Recombinant PSPH Protein for Research
Recombinant Human PSPH Protein is widely used in research studies to understand its role in different cellular processes. The protein can be produced in large quantities using recombinant DNA technology, making it readily available for various biochemical and structural studies.

2. Diagnostic Assays
The activity of recombinant human PSPH protein can be measured in diagnostic assays to assess the levels of this enzyme in biological samples. Abnormal levels of PSPH protein have been linked to various diseases, including cancer and neurological disorders, making it a potential biomarker for disease diagnosis.

3. Therapeutic Applications
Recombinant Human PSPH Protein has also shown potential as a therapeutic target for various diseases. Inhibitors of this enzyme have been developed and tested for their efficacy in treating cancer and other diseases that are characterized by an overactive L-serine biosynthetic pathway.

4. Vaccine Development
Recombinant Human PSPH Protein has been identified as a potential antigen for vaccine development. This is due to its high immunogenicity and ability to induce an immune response in the body. Vaccines targeting PSPH protein could potentially offer protection against diseases associated with abnormal levels of this enzyme.

5. Nutritional Supplements
L-serine is an essential amino acid that is required for proper functioning of the body. Recombinant Human PSPH Protein can be used to produce nutritional supplements that provide a source of L-serine for individuals with deficiencies or increased demand for this amino acid.

Title: Conclusion

Recombinant Human PSPH Protein is a crucial enzyme involved in the biosynthesis of L-serine, an essential amino acid. Its unique structure and activity make it an important target for research, diagnostics, therapeutics, and vaccine development. With further studies, this protein could potentially offer new insights and treatments for various diseases.

Recombinant Human PSPH Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PSPH Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products